KEGG   Methanobacterium sp. AL-21: Metbo_1926Help
Entry
Metbo_1926        CDS       T01437                                 

Definition
histone acetyltransferase (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mel  Methanobacterium sp. AL-21
Brite
Enzymes [BR:mel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Metbo_1926
Transfer RNA biogenesis [BR:mel03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Metbo_1926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1971808..1973436
Genome map
AA seq 542 aa AA seqDB search
MEDACRFIIDEILTGKINSKRDLEKVKLKACRDFKLMEFMSNSLILEKASPEERKIIAPI
IRKKPTRTISGVAVVAVMCKPHKCPHGRCTYCPESEVAPPSYTGEEPAALRARMYKFDPY
MQTYNRLLQLESIGHPIDKVELIVMGGTFPSYNVCYQEWFITKCLRAMNDFGLEDLDTKV
KIRKTGELKVPEDFAYLKDVQIKNELSSVRCVGMTFETRPDYAKIEDIDRMLNMGVTRVE
LGVQTIYNFIYKRIERGHRVEDAVKSAQYLRDSGIKVAFHMMPGLFSDPDRDMRIFHRIF
EDEKFRPDMIKIYPCLVTKGSKLYDLWKAGDYEPYSTEDAVDLIVKVKKILPKWVRTMRI
QRDIPSQLIEAGVKKSNLGELVYNKLEGEGVNCKCIRCREVGHRAANGVIPDFHNVDLVK
TEYNAAGGREIFLSQEDLSKDILMGFLRLRIPSENAHRVEVDDKTALIRELHVYGQMAEI
GQKSDELYQHMGFGEQLLQEAERVASEEFDRKKLLIISGLGARDYYRKFGYELEGPYMSK
KI
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggaagacgcatgcagatttatcatagatgaaatactcacaggcaagattaacagcaaa
agagaccttgaaaaggttaagttaaaggcatgtagagacttcaaattaatggaatttatg
agtaattcattgatactcgagaaggccagtcctgaggaaaggaagatcatagcaccgatt
atccgaaaaaaacccaccagaaccatatcaggtgttgctgtggtggctgttatgtgcaaa
ccacataaatgcccccatggaagatgtacctactgtccagaaagtgaagttgcaccacca
agttacacaggagaagaaccagcagcactcagggcaaggatgtacaaatttgatccctat
atgcagacttacaacaggctattacaacttgaaagtattggacatcccattgacaaagtg
gaactcattgtaatgggaggcacatttccatcctacaatgtatgttaccaagaatggttc
ataacaaaatgtttaagggcaatgaatgactttggattggaagatcttgacaccaaggtt
aagatcaggaaaactggagagttaaaagttccagaagacttcgcgtacctcaaagatgta
cagataaaaaatgagctgtccagtgtgaggtgtgtgggcatgaccttcgaaacccggcct
gactacgcaaaaattgaagacatcgatcgaatgcttaacatgggagttacaagggttgaa
cttggagttcaaaccatatacaactttatctacaaacgtatcgaaagaggccatagggtg
gaggatgcagtgaaatcagcccagtatcttagggactctggaatcaaggtagcgtttcat
atgatgcctggacttttctcagacccggatcgtgacatgagaatatttcacaggatcttt
gaagatgaaaaattcagacccgacatgataaaaatatatccatgcctggttaccaagggc
tcaaaactctacgacctatggaaagccggagattatgaaccctacagcaccgaagatgcc
gttgatctaatagttaaagtgaagaaaatacttcctaaatgggtcagaaccatgaggata
caacgggacataccttcacagcttatagaagctggtgtgaaaaaatctaaccttggagaa
ctggtttacaacaagttggaaggggaaggtgtgaactgtaaatgtatccggtgccgtgaa
gttggacacagagccgccaatggagtaattccagatttccacaatgttgacctggttaaa
acagaatacaatgctgctggaggacgtgaaatattcctttcacaggaagacctgagcaaa
gacattttaatgggatttttaaggctcagaataccatctgaaaatgcccatagggttgag
gtagatgataaaacagcactcataagggagctgcatgtctacggtcaaatggcagaaatt
ggacaaaagagtgatgaactgtaccagcacatgggattcggagaacaactgcttcaggaa
gctgagagagtagcgtctgaagaatttgacaggaaaaaactcctaataatcagtggtttg
ggagccagagattactacagaaaatttggatacgaattagaaggaccctacatgtctaaa
aaaatttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system