KEGG   Methanobacterium lacus: Metbo_2043Help
Entry
Metbo_2043        CDS       T01437                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mel  Methanobacterium lacus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mel00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Metbo_2043
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Metbo_2043
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Metbo_2043
Enzymes [BR:mel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Metbo_2043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2086572..2087396)
Genome map
AA seq 274 aa AA seqDB search
MNPNNQKTKTYKEVFEELKNKNEGAFIPFVVAGDPNFETSIEIVKKFVENGADALEIGFP
FSDPVADGPSVQTADIRALESGMTTEKCFKFIERIREFTQVPIGLLVYYNLIYRKGIETF
YKRASEAGVTGILAADLPIEEAGSAVEMADKYGVNQIFMVAQTTRNERIDEIAKHASGFL
YVVAVMGVTGARSDIQTSTVDLITRVKDRTDLPIAVGFGISKPEHVRDVIKSGSNGAIVA
SAIINIITANLDNKDKALEEIGKFCSELKQSTKI
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaacccaaacaaccagaaaaccaagacctacaaagaagtatttgaagaacttaaaaac
aagaatgaaggagcattcataccatttgtagttgcaggggaccctaactttgaaacatcc
atcgagatagttaaaaaattcgttgaaaacggggcagacgcacttgaaattggattccca
tttagtgatcctgttgcagacggtccaagtgtacaaacagcagatatccgtgcacttgaa
tctggaatgaccacagagaagtgcttcaaattcatagaaagaattcgtgaatttacccag
gtacctataggactgcttgtttactacaacctcatctacaggaagggcattgaaacattt
tacaaacgtgccagtgaagcaggtgtaactggaattcttgcagcagaccttccaatagaa
gaagcaggatccgcagttgaaatggcagacaagtacggtgtcaatcaaatattcatggtt
gcacagacaaccagaaacgagaggatcgatgaaatagctaaacatgcatcaggatttctc
tacgttgtggccgtcatgggtgtgacaggcgcaagatcagacatccaaacaagcacagtt
gatctcataacaagggttaaagatcgtacagatctaccaattgcagttggctttggaatt
tcaaaacctgaacatgtgcgggacgttataaaatcaggatccaacggtgcaatagtagcc
agtgccatcataaacatcatcacagctaaccttgacaacaaagacaaggcactcgaagag
attggtaaattctgcagtgaacttaaacaatcaaccaagatatag

DBGET integrated database retrieval system