KEGG   Methanobacterium sp. AL-21: Metbo_2084Help
Entry
Metbo_2084        CDS       T01437                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mel  Methanobacterium sp. AL-21
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mel00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Metbo_2084
   00052 Galactose metabolism
    Metbo_2084
   00500 Starch and sucrose metabolism
    Metbo_2084
   00520 Amino sugar and nucleotide sugar metabolism
    Metbo_2084
Enzymes [BR:mel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Metbo_2084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2130301..2131146)
Genome map
AA seq 281 aa AA seqDB search
MKAVIPAAGLGTRFLPATKAQPKEMLPVFNKPTIQYVVEEAVASGIDDILIITGKGKRSI
EDHFDKSFELEYFLKSSGKTERLHEIESISEMADIYYVRQKKQEGLGDAIRCAKKHVDGD
AFAVLLGDTIARSKVPCTKQLLDIYNKYEASTIAIEKVPDEKVERYGIIGGKQISEDLYE
IQELVEKPKLENAPSNLAITGRYVFAPEIFDHLAHINPGFGGEIQLTDAMKSLTKIYGHI
YDGKIYDIGNTVEWLKSSVEIALEDPEVGEDLRSYLTGIIK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggttatacctgctgcgggtttgggtacaagatttttacctgccactaaagca
cagccaaaggaaatgttacctgtattcaataaaccaaccattcaatacgtggttgaagag
gcagtagcatctggaattgacgacattctcataataacaggtaaaggtaaaagatcaata
gaagatcattttgataaatcattcgagttggaatatttccttaaaagttctggtaaaact
gaaagactccacgaaatcgagtccatatctgaaatggctgatatttattatgtgagacag
aagaaacaagaaggacttggtgatgcaataagatgcgccaagaaacatgttgatggtgat
gcatttgcagttcttctaggtgacacaatagcaaggtcaaaggtaccatgcacaaaacag
ctgttagacatatacaacaagtacgaagcatcaaccattgccattgaaaaggttcctgac
gaaaaggttgaaaggtacggaataattggtggcaaacagatctcagaagatctctacgag
atccaggaactggttgaaaaacccaaactcgagaatgcaccatccaaccttgcaatcaca
ggaagatacgtctttgcacctgagatatttgatcatctagcacatatcaatcctggtttt
ggtggggaaatacaactaaccgatgcaatgaaatcattaaccaaaatttacggccacata
tacgatggaaagatctacgatattggaaacacagtagaatggcttaaaagttctgtagaa
attgcactcgaagatccagaagtaggagaagacctgagatcctacctaacaggaataatc
aaataa

DBGET integrated database retrieval system