KEGG   Methanobacterium lacus: Metbo_2084Help
Entry
Metbo_2084        CDS       T01437                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mel  Methanobacterium lacus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mel00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Metbo_2084
   00052 Galactose metabolism
    Metbo_2084
   00500 Starch and sucrose metabolism
    Metbo_2084
   00520 Amino sugar and nucleotide sugar metabolism
    Metbo_2084
Enzymes [BR:mel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Metbo_2084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2130301..2131146)
Genome map
AA seq 281 aa AA seqDB search
MKAVIPAAGLGTRFLPATKAQPKEMLPVFNKPTIQYVVEEAVASGIDDILIITGKGKRSI
EDHFDKSFELEYFLKSSGKTERLHEIESISEMADIYYVRQKKQEGLGDAIRCAKKHVDGD
AFAVLLGDTIARSKVPCTKQLLDIYNKYEASTIAIEKVPDEKVERYGIIGGKQISEDLYE
IQELVEKPKLENAPSNLAITGRYVFAPEIFDHLAHINPGFGGEIQLTDAMKSLTKIYGHI
YDGKIYDIGNTVEWLKSSVEIALEDPEVGEDLRSYLTGIIK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggttatacctgctgcgggtttgggtacaagatttttacctgccactaaagca
cagccaaaggaaatgttacctgtattcaataaaccaaccattcaatacgtggttgaagag
gcagtagcatctggaattgacgacattctcataataacaggtaaaggtaaaagatcaata
gaagatcattttgataaatcattcgagttggaatatttccttaaaagttctggtaaaact
gaaagactccacgaaatcgagtccatatctgaaatggctgatatttattatgtgagacag
aagaaacaagaaggacttggtgatgcaataagatgcgccaagaaacatgttgatggtgat
gcatttgcagttcttctaggtgacacaatagcaaggtcaaaggtaccatgcacaaaacag
ctgttagacatatacaacaagtacgaagcatcaaccattgccattgaaaaggttcctgac
gaaaaggttgaaaggtacggaataattggtggcaaacagatctcagaagatctctacgag
atccaggaactggttgaaaaacccaaactcgagaatgcaccatccaaccttgcaatcaca
ggaagatacgtctttgcacctgagatatttgatcatctagcacatatcaatcctggtttt
ggtggggaaatacaactaaccgatgcaatgaaatcattaaccaaaatttacggccacata
tacgatggaaagatctacgatattggaaacacagtagaatggcttaaaagttctgtagaa
attgcactcgaagatccagaagtaggagaagacctgagatcctacctaacaggaataatc
aaataa

DBGET integrated database retrieval system