KEGG   Methanobacterium sp. AL-21: Metbo_2118Help
Entry
Metbo_2118        CDS       T01437                                 

Definition
Uroporphyrinogen-iii synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mel  Methanobacterium sp. AL-21
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mel00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Metbo_2118
Enzymes [BR:mel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Metbo_2118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2164539..2165324
Genome map
AA seq 261 aa AA seqDB search
MKGKEFEGKVIGITRPEERVKEAVAIVEEHGGTALVAPTLELQVSNTQSLIQLCEMAGEL
DWLIFTSPTGIISVFKHCSDLKTRLNPNCKIAVIGPRTENYLEKKGLKADIVPESYTAEG
LLECFEDHDLKNKKIGIPRTLAARDALPTGLKVMGADVFVAEAYKSDLPKDRTRVNQLVE
AILNRKINALTFTSTLTVKNLFDMLDETEKQDVVDILKSDDVVVAAIGPVTAMPLHELDI
DVLIPEKYTVSAMLEILMGKI
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaagggtaaagaatttgagggtaaagtaattggtatcacccgtcctgaagaaagggtt
aaagaggctgttgctattgtggaagaacatggaggtactgcacttgtggcacccacactc
gaactccaggtatccaacacccaatccctgatccaactctgtgaaatggcaggagaactt
gattggctgatattcacatccccaaccggaatcatatctgtatttaaacactgcagtgac
cttaaaacccgattgaatcccaactgcaagatagctgttatagggcccagaactgaaaat
tatctggaaaaaaagggactcaaggcagatattgttcctgaaagttacactgcagagggt
ttgcttgaatgcttcgaggatcatgacttgaaaaacaaaaagataggtattccaagaact
ctggctgccagagatgctcttccaactggtttgaaggttatgggtgcggatgtttttgtt
gctgaagcctataaatcagaccttccaaaggacaggacaagggttaaccagctcgtagaa
gccattctaaacaggaagatcaatgctttgaccttcacaagtacgttgacagttaaaaat
ctctttgacatgttggatgaaactgaaaaacaggatgttgttgacattttaaagagtgac
gatgtggttgttgcagctattggccctgtaactgccatgcctctgcatgaactggatatt
gatgtgttaatacctgaaaagtacactgttagtgccatgcttgagattttgatgggtaaa
atataa

DBGET integrated database retrieval system