KEGG   Methanobacterium lacus: Metbo_2215Help
Entry
Metbo_2215        CDS       T01437                                 

Definition
Mur ligase middle domain-containing protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mel  Methanobacterium lacus
Pathway
Lysine biosynthesis
Brite
KEGG Orthology (KO) [BR:mel00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Metbo_2215
Enzymes [BR:mel01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Metbo_2215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2246914..2248374
Genome map
AA seq 486 aa AA seqDB search
MTELTTSYLANKIDGKLTGPDIVIQGIFTFLNHAKPGDAVIRHWIDEKGVEIARNRGVSC
VVTQNPKGDAVKTAQELDFPLIITPKIELANAFALRWSIEKFAPGSIRVVVTGTNGKSTT
THMIQNILNHAGYNCYTNTDSKSEFNTLIDPVVSDQISRFKAKTKKPIDAMVVEVSEVQG
WMDKLMKDHAYLMTDAVKPDVLVLTNITMDHIGLINSIEETYAEIYGALAAVEKSCQNNY
AVLNYDDPLLRKMAGEIVTCPSIISHGSVEPDFNPDLTVKSDGIHHEDELFLKMEDLPFK
SKHFLQNTMAAIGACLALNIDTSAIKAGILSYSPLNRRFSILYQEPLIIDDFAHNPDGIT
ATIKSASEMSEGTLIILFAVRGSRGEVINRLNAEALASALQAVDYSLIITSSSEVVDELN
TVHASEIEVVRKVMDEHKLEHTFKEELEDALNYTLNTAKKEDTILLIGAQGMDPAKDILN
RIKGPE
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgacagaattaacaacttcctatctggccaataaaatcgatggaaaattaacagggcca
gatatagttattcagggaattttcaccttcttaaaccatgcaaaacctggagatgcagtt
attagacattggatcgatgaaaagggtgtggaaatagcaagaaataggggtgtttcatgt
gttgttactcaaaaccccaagggtgatgccgtgaaaacagcacaagaacttgattttcca
ttgataatcaccccaaaaattgaacttgccaatgcatttgcactcagatggtccattgaa
aaatttgcccctggatccatacgagtggttgtaacaggcaccaatggaaagtcaacaaca
acccacatgatacaaaacatacttaatcatgcaggttacaactgttacaccaacacagat
tctaaatctgaatttaacaccttgattgaccctgttgtttctgatcaaatatcacgtttc
aaagcaaaaaccaaaaaacccattgatgcaatggtggtagaagtttcagaagttcaggga
tggatggataagctcatgaaagatcatgcttacctaatgacagatgcagttaaaccagat
gttctggttctgaccaacataaccatggatcatattggtctaatcaattccattgaagaa
acctacgccgagatatacggagccctggctgcagtagaaaaatcatgccaaaataactac
gctgttttaaattatgatgatccgcttctaagaaaaatggctggagaaattgtgacctgt
ccaagcataatatcccacggttctgttgaaccagattttaatccggatctaactgttaaa
tccgacggaatacaccatgaagatgaactgtttttaaagatggaagatcttccatttaaa
agtaagcacttcctacaaaatacaatggcagccataggtgcgtgtttggcactgaacatc
gataccagtgccataaaagctggaattttgtcttacagtccattaaacagaagattttca
attctttaccaagaacctttgataatagatgatttcgcccacaaccccgacggaatcaca
gcaaccattaaaagcgcctctgaaatgtctgaaggcaccctgattatcttgtttgcagtc
cgaggatctaggggcgaagtcataaaccgtttaaatgcagaggcacttgcatctgccctt
caagccgttgattactccctgattattacaagcagttctgaagttgttgacgagttgaac
actgttcatgcctctgaaattgaggttgtgaggaaagttatggatgaacataaactagaa
cacaccttcaaagaagaactggaagatgccctaaattacaccttgaacaccgcaaaaaag
gaagatactattctattaattggtgcccagggaatggatcctgctaaggacattttaaac
cggataaaaggtccagaataa

DBGET integrated database retrieval system