KEGG   Methanobacterium lacus: Metbo_2349Help
Entry
Metbo_2349        CDS       T01437                                 

Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
mel  Methanobacterium lacus
Pathway
mel00330  Arginine and proline metabolism
mel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mel00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Metbo_2349
Enzymes [BR:mel01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Metbo_2349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: ADZ10562
JGI: Metbo_2349
UniProt: F0T655
Position
2390354..2391232
Genome map
AA seq 292 aa AA seqDB search
MFLHTENVLKFAFSNETNDPYETSESLKFGILGVPFDGTTSYLPGARFGPRTVREASYNF
EAYNFQLKKTVPTGVLDLGDIEVVHGNFKKTCSKLKSTIDDVLSQNIIPISIGGDHSISF
CIINAITQALGENKLTVIHFDAHMDLRDEYGGEKYSHATVMRRILDLNPLQLIQIGVRSA
AEEEATLSDERLTSFSSHQVCEDIENIINCLKNISGPIYISFDIDVLDPAYAPSTGTPSP
CGLDPMQIEKLILNLESKELVGMDLVEVASTEIGDSTAMNAAKIIFDFLCLH
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgtttttacacacagaaaatgttttaaaatttgcattttcaaatgaaacaaatgatcca
tatgaaacatctgaatcattgaagtttggtattttaggagtcccatttgatggtactacc
agctacttacctggtgccagatttggacctaggactgttagggaagcatcttacaacttt
gaagcctacaactttcagttgaaaaaaactgttcccacaggagtactggatcttggagat
attgaagtggtgcatggaaacttcaaaaaaacttgttccaaactaaaatcaaccattgat
gatgttttatcccaaaatattatcccaatatccattggtggagatcacagcataagtttc
tgtataatcaatgccattacccaagctttgggagagaataaactcactgtaatccatttt
gatgcccatatggatcttcgcgacgagtatgggggcgaaaaatattcacatgcaactgtg
atgagaaggatacttgatctaaatccactgcaacttattcagataggggtgagatcagcg
gccgaagaagaggcaaccctttcagatgaaaggttaaccagtttcagttcccatcaagta
tgtgaagatattgaaaatattataaattgtctaaaaaacatctccggccccatatacatt
agttttgatattgatgtccttgaccctgcatatgcaccctcaactggaactccctctcca
tgcggattagatcccatgcagatagaaaaactaatactaaatcttgaatcgaaggaatta
gttggaatggaccttgttgaagttgcttccacagaaattggcgactcaaccgccatgaat
gctgctaaaattatttttgattttttgtgtctgcactaa

DBGET integrated database retrieval system