KEGG   Methanobacterium sp. AL-21: Metbo_2349Help
Entry
Metbo_2349        CDS       T01437                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mel  Methanobacterium sp. AL-21
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mel00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Metbo_2349
Enzymes [BR:mel01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Metbo_2349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2390354..2391232
Genome map
AA seq 292 aa AA seqDB search
MFLHTENVLKFAFSNETNDPYETSESLKFGILGVPFDGTTSYLPGARFGPRTVREASYNF
EAYNFQLKKTVPTGVLDLGDIEVVHGNFKKTCSKLKSTIDDVLSQNIIPISIGGDHSISF
CIINAITQALGENKLTVIHFDAHMDLRDEYGGEKYSHATVMRRILDLNPLQLIQIGVRSA
AEEEATLSDERLTSFSSHQVCEDIENIINCLKNISGPIYISFDIDVLDPAYAPSTGTPSP
CGLDPMQIEKLILNLESKELVGMDLVEVASTEIGDSTAMNAAKIIFDFLCLH
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgtttttacacacagaaaatgttttaaaatttgcattttcaaatgaaacaaatgatcca
tatgaaacatctgaatcattgaagtttggtattttaggagtcccatttgatggtactacc
agctacttacctggtgccagatttggacctaggactgttagggaagcatcttacaacttt
gaagcctacaactttcagttgaaaaaaactgttcccacaggagtactggatcttggagat
attgaagtggtgcatggaaacttcaaaaaaacttgttccaaactaaaatcaaccattgat
gatgttttatcccaaaatattatcccaatatccattggtggagatcacagcataagtttc
tgtataatcaatgccattacccaagctttgggagagaataaactcactgtaatccatttt
gatgcccatatggatcttcgcgacgagtatgggggcgaaaaatattcacatgcaactgtg
atgagaaggatacttgatctaaatccactgcaacttattcagataggggtgagatcagcg
gccgaagaagaggcaaccctttcagatgaaaggttaaccagtttcagttcccatcaagta
tgtgaagatattgaaaatattataaattgtctaaaaaacatctccggccccatatacatt
agttttgatattgatgtccttgaccctgcatatgcaccctcaactggaactccctctcca
tgcggattagatcccatgcagatagaaaaactaatactaaatcttgaatcgaaggaatta
gttggaatggaccttgttgaagttgcttccacagaaattggcgactcaaccgccatgaat
gctgctaaaattatttttgattttttgtgtctgcactaa

DBGET integrated database retrieval system