KEGG   Methanobacterium sp. AL-21: Metbo_2379Help
Entry
Metbo_2379        CDS       T01437                                 

Definition
glyceraldehyde-3-phosphate dehydrogenase (EC:1.2.1.59)
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mel  Methanobacterium sp. AL-21
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:mel01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mel01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mel00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2419973..2420989
Genome map
AA seq 338 aa AA seqDB search
MKAVGINGYGTIGKRVADAVSAQDDMKIVGVTKRTPNFEAKRAVELGYDIYMSAPDRENL
FEEADIPVKGTINDLYDKVDVIVDCTPGGVGAKNMADYEKAGVKGIFQGGEKHDQIGRSF
NSFSNFKESVGADFTRVVSCNTTGLCRTLNPIKELAGINKVRAVMVRRGADPGQVNKGPI
NSIVPNPPTVPSHHGPDVQTVMKGLKITTMAILVPTTLMHQHNLMVELDSSVSVDDVLDV
LEKTPRVIPVEASSGLGSTAEIMEFAKDLGRPRGDLFEIAVWKESLNIVDNELFYMQAIH
QESDVVPENVDAIRAMLEMETDPQKSIAKTNKNMGIIG
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgttggaataaacggatacggtaccataggtaaaagagtagcagatgcagtt
tctgcacaggatgatatgaaaattgttggtgttacaaaaagaactccgaattttgaagct
aaacgggccgttgaactaggttacgatatttatatgagtgccccagatagggaaaatttg
tttgaagaggcagacattcctgttaaaggcacaattaatgacctttatgataaagtagat
gtgatagtagactgcacacccggcggagtgggtgctaaaaacatggcagactatgaaaag
gctggagtcaaaggaatatttcagggcggtgaaaaacacgaccagataggaagatccttc
aactcattttcaaacttcaaagaatctgttggtgcggactttacaagggtggtctcttgt
aacacaactggtttgtgtagaacattaaacccaattaaagaacttgcaggcataaataag
gtcagagcagtcatggtaaggcgtggtgcagatcctggacaggtaaacaagggtccaatc
aattcaatagtacctaacccgccaactgtgccttctcaccatggtccagatgtacaaact
gttatgaaaggactaaaaataaccacaatggcaattttggttccaacaacactcatgcat
cagcacaacctcatggttgaacttgattccagtgtcagtgtggatgatgttctagatgtt
cttgaaaaaactcctagggtaattcctgttgaagcttccagtggtttaggttccactgcg
gagatcatggagtttgcaaaggatcttggaaggcctagaggagatctgtttgaaatagct
gtctggaaggaatccctcaacatcgtggacaacgaactattttacatgcaggcaatacat
caagaatcggatgtggttcctgaaaatgttgatgcaatacgtgcaatgcttgaaatggaa
acagacccacagaaatccattgcaaaaaccaataaaaacatgggcataattggttaa

DBGET integrated database retrieval system