KEGG   Methanobacterium lacus: Metbo_2401Help
Entry
Metbo_2401        CDS       T01437                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mel  Methanobacterium lacus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metbo_2401
   01230 Biosynthesis of amino acids
    Metbo_2401
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metbo_2401
   00051 Fructose and mannose metabolism
    Metbo_2401
   00562 Inositol phosphate metabolism
    Metbo_2401
Enzymes [BR:mel01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Metbo_2401
Exosome [BR:mel04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Metbo_2401
  Exosomal proteins of bladder cancer cells
   Metbo_2401
  Exosomal proteins of melanoma cells
   Metbo_2401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2444579..2445259)
Genome map
AA seq 226 aa AA seqDB search
MNNTKRTPIVILNFKTYLESTGINAVNLATASEMVAEETGINMVVAPQSSDIYQLSNKVN
IPVFAQHIDAVDAGGHTGSTLIECVKEAGADGSLINHSEQRMKLADIDVAVKKLAQKNMV
SVLCTNNIETSAAVATLKPDFVAIEPPELIGSGIPVSKAEPEIVEGTVEVIHKIDPEISV
LCGAGISTGDDMKAAMDLGADGVLLASGIIKADDPKEALLNLVSKI
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaataataccaagagaactccaatagtaatcttaaatttcaaaacgtatctagaatca
actggaataaatgctgtcaaccttgcaacagcttctgagatggttgcagaagaaacaggt
atcaacatggtggttgcaccacaaagttcagacatataccaattgtctaacaaagttaac
atacctgtttttgcccagcacatcgatgctgtggatgcaggtggccatacaggaagcaca
ctcattgaatgtgttaaagaggccggagcagatggaagtttaataaatcattctgaacag
agaatgaaacttgctgatattgatgttgcagtgaaaaagcttgcccaaaaaaacatggtt
agtgtgctgtgcacaaacaatatcgaaaccagtgcagcagtggccacattgaaacctgat
tttgttgccatcgaacctccggaactcataggatcaggaattccagtctccaaggccgaa
cctgaaattgttgagggtactgtagaagtaatccacaaaatagatccagaaataagtgtt
ctttgtggagcaggaatatcaacgggagacgatatgaaggcagcaatggatctgggtgca
gacggtgttttactcgcatctggaattatcaaggccgatgatcctaaagaagccctactc
aaccttgtaagcaagatataa

DBGET integrated database retrieval system