KEGG   Methanobacterium sp. AL-21: Metbo_2401Help
Entry
Metbo_2401        CDS       T01437                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mel  Methanobacterium sp. AL-21
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:mel01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mel01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mel00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mel00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:mel00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2444579..2445259)
Genome map
AA seq 226 aa AA seqDB search
MNNTKRTPIVILNFKTYLESTGINAVNLATASEMVAEETGINMVVAPQSSDIYQLSNKVN
IPVFAQHIDAVDAGGHTGSTLIECVKEAGADGSLINHSEQRMKLADIDVAVKKLAQKNMV
SVLCTNNIETSAAVATLKPDFVAIEPPELIGSGIPVSKAEPEIVEGTVEVIHKIDPEISV
LCGAGISTGDDMKAAMDLGADGVLLASGIIKADDPKEALLNLVSKI
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaataataccaagagaactccaatagtaatcttaaatttcaaaacgtatctagaatca
actggaataaatgctgtcaaccttgcaacagcttctgagatggttgcagaagaaacaggt
atcaacatggtggttgcaccacaaagttcagacatataccaattgtctaacaaagttaac
atacctgtttttgcccagcacatcgatgctgtggatgcaggtggccatacaggaagcaca
ctcattgaatgtgttaaagaggccggagcagatggaagtttaataaatcattctgaacag
agaatgaaacttgctgatattgatgttgcagtgaaaaagcttgcccaaaaaaacatggtt
agtgtgctgtgcacaaacaatatcgaaaccagtgcagcagtggccacattgaaacctgat
tttgttgccatcgaacctccggaactcataggatcaggaattccagtctccaaggccgaa
cctgaaattgttgagggtactgtagaagtaatccacaaaatagatccagaaataagtgtt
ctttgtggagcaggaatatcaacgggagacgatatgaaggcagcaatggatctgggtgca
gacggtgttttactcgcatctggaattatcaaggccgatgatcctaaagaagccctactc
aaccttgtaagcaagatataa

DBGET integrated database retrieval system