KEGG   Methanobacterium lacus: Metbo_2401Help
Entry
Metbo_2401        CDS       T01437                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mel  Methanobacterium lacus
Pathway
mel00010  Glycolysis / Gluconeogenesis
mel00051  Fructose and mannose metabolism
mel00562  Inositol phosphate metabolism
mel01100  Metabolic pathways
mel01110  Biosynthesis of secondary metabolites
mel01120  Microbial metabolism in diverse environments
mel01130  Biosynthesis of antibiotics
mel01200  Carbon metabolism
mel01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mel00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metbo_2401
   00051 Fructose and mannose metabolism
    Metbo_2401
   00562 Inositol phosphate metabolism
    Metbo_2401
Enzymes [BR:mel01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Metbo_2401
Exosome [BR:mel04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Metbo_2401
  Exosomal proteins of bladder cancer cells
   Metbo_2401
  Exosomal proteins of melanoma cells
   Metbo_2401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG NMO FMN_dh His_biosynth IGPS Glu_synthase
Motif
Other DBs
NCBI-ProteinID: ADZ10614
JGI: Metbo_2401
UniProt: F0T6I0
Position
complement(2444579..2445259)
Genome map
AA seq 226 aa AA seqDB search
MNNTKRTPIVILNFKTYLESTGINAVNLATASEMVAEETGINMVVAPQSSDIYQLSNKVN
IPVFAQHIDAVDAGGHTGSTLIECVKEAGADGSLINHSEQRMKLADIDVAVKKLAQKNMV
SVLCTNNIETSAAVATLKPDFVAIEPPELIGSGIPVSKAEPEIVEGTVEVIHKIDPEISV
LCGAGISTGDDMKAAMDLGADGVLLASGIIKADDPKEALLNLVSKI
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaataataccaagagaactccaatagtaatcttaaatttcaaaacgtatctagaatca
actggaataaatgctgtcaaccttgcaacagcttctgagatggttgcagaagaaacaggt
atcaacatggtggttgcaccacaaagttcagacatataccaattgtctaacaaagttaac
atacctgtttttgcccagcacatcgatgctgtggatgcaggtggccatacaggaagcaca
ctcattgaatgtgttaaagaggccggagcagatggaagtttaataaatcattctgaacag
agaatgaaacttgctgatattgatgttgcagtgaaaaagcttgcccaaaaaaacatggtt
agtgtgctgtgcacaaacaatatcgaaaccagtgcagcagtggccacattgaaacctgat
tttgttgccatcgaacctccggaactcataggatcaggaattccagtctccaaggccgaa
cctgaaattgttgagggtactgtagaagtaatccacaaaatagatccagaaataagtgtt
ctttgtggagcaggaatatcaacgggagacgatatgaaggcagcaatggatctgggtgca
gacggtgttttactcgcatctggaattatcaaggccgatgatcctaaagaagccctactc
aaccttgtaagcaagatataa

DBGET integrated database retrieval system