KEGG   Methanobacterium lacus: Metbo_2405Help
Entry
Metbo_2405        CDS       T01437                                 

Definition
succinyl-CoA ligase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mel  Methanobacterium lacus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metbo_2405
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Metbo_2405
   00640 Propanoate metabolism
    Metbo_2405
   00660 C5-Branched dibasic acid metabolism
    Metbo_2405
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metbo_2405
Enzymes [BR:mel01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Metbo_2405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2448943..2450049)
Genome map
AA seq 368 aa AA seqDB search
MKIHEYIAKEIFKAEGIPVPASQMVKNSEDAHKAALEINKPVAIKSQILVGGRGKAGGIQ
FATDPDEARDVSSKILGSTVKGELVEMVLVEEKLSIESEFYVSVVLDRSAKKPLIMASSS
GGMEIEEVATETPEKIVKYYINSLDEFLPYQGREIAIKMGIPNELISKVGGIIWKLVQIF
DKYDATIAEINPLVLTKEGIIAADAKLDIDDDALYRQKKLVELENIKSGEFAYVKLDGNI
AVIGNGAGLTLSGMDMLKLYGGEPATFLDIGGGSSRENIAKALNIVISDPDVKTVFLNVL
GGITRADDVARGVLDVMKESERKIPLVIRLTGTNEEEGQKILKDAGVSFETSMEAAAQKA
VELCSTKN
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcatgaatacattgccaaggaaatttttaaagcagagggaatacctgtacct
gcaagccagatggttaaaaattcagaagatgcacacaaagctgcccttgaaataaataaa
cccgtggccatcaaatcacagatcctggtcggtggtagaggtaaggcaggaggaatacaa
tttgcaacagatccagatgaagcacgtgatgtttcctcgaaaattttaggttcaactgtt
aagggtgagttagttgaaatggttctggtggaagaaaaattgtccattgaatctgaattc
tacgtgagtgtagttctggatagatcagctaaaaaaccactcatcatggccagcagttcc
ggtggcatggaaatagaagaagttgccacggaaacacccgaaaaaattgttaaatattat
ataaatagtttagacgaatttttaccttatcaaggaagggaaattgccataaaaatggga
attcctaatgagctcatttccaaggttggtgggataatatggaaactggtacaaatattt
gacaagtacgatgcaaccatagcagagattaacccattggtactcaccaaggaaggaatt
atagctgcagatgctaagctggatattgatgacgacgccttatacaggcaaaaaaaactg
gttgaacttgaaaatatcaaatctggagaatttgcatacgtgaaactggatggaaacatt
gcagtgataggtaacggtgcaggattaaccctgagtggaatggatatgttaaaactttat
gggggcgaaccagccacatttcttgacataggtggcggatcatccagagaaaacatagca
aaagcactcaacatagtaatatcggatcctgatgttaaaacagtatttttaaatgtttta
ggtggaatcacaagggccgatgatgttgcaaggggagtccttgatgttatgaaagaatct
gaaagaaaaatacccctggtaattcgtttaactggaaccaacgaagaggaaggtcagaaa
attcttaaagatgcaggagtttccttcgagacatccatggaagcagcggcacaaaaggct
gttgaactctgtagcacaaaaaattaa

DBGET integrated database retrieval system