KEGG   Methanobacterium lacus: Metbo_2435Help
Entry
Metbo_2435        CDS       T01437                                 

Definition
F420-0:gamma-glutamyl ligase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
mel  Methanobacterium lacus
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mel00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Metbo_2435
Enzymes [BR:mel01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     Metbo_2435
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     Metbo_2435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2473385..2474146
Genome map
AA seq 253 aa AA seqDB search
MCVKLIGIKNIPMIGQGDDVGTIIIEAAKSEGLEIMDHDVFVVAETVVSKAEGNLIKLDS
IEVSEQALEISEKTSKDPRIVQTIIDESVEIIKVGPNFIISETKHGFVCANAGIDESNVE
TGFLKPIPHDSDESASIIRTTIESATGKNVAVILSDTQGRPFREGAVGVALGVSGIDPVW
NRQGETDLFERELETTTIAVADELASAASIVMGQAAEGLPVIIVRGVEYAEKLRSTTSNI
KPILRPKKFDVFR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgtgaaactcattggcattaaaaacataccaatgataggtcaaggagatgatgtt
ggaaccatcatcatcgaagctgcaaaatctgagggtcttgaaataatggatcatgatgtt
tttgtggttgcagaaactgtggtttcaaaggctgaaggaaatttgataaaactggattca
atagaggtcagtgaacaagccctagaaatttccgaaaaaacatcgaaggatcctaggatc
gttcaaacaataattgatgaatccgtagaaattatcaaagtcggacctaacttcataata
tccgaaacaaaacatggttttgtatgtgcaaatgccggcattgatgagtccaatgtagaa
actggttttctaaaacccattccccatgattcagatgagagtgcttccataattaggaca
accattgagtctgctacaggaaaaaatgtagcagtaatattatctgacacacaaggccgt
ccattcagggaaggtgcagttggagttgcactgggagtatctggtatagatccagtttgg
aacagacaaggagaaacagatctctttgagagagaacttgaaacaaccaccatagctgtt
gcagatgaattggcatcagcagcttccattgtaatgggccaagcagctgagggtttgcca
gtcataatagtacgaggtgtggaatacgctgaaaaattgagatccaccacttcaaatata
aaacctattctaagaccaaagaaattcgatgtttttagatga

DBGET integrated database retrieval system