KEGG   Methanobacterium sp. AL-21: Metbo_2455Help
Entry
Metbo_2455        CDS       T01437                                 

Definition
butyrate--CoA ligase (EC:6.2.1.2)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mel  Methanobacterium sp. AL-21
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Class
Metabolism; Overview; Carbon metabolism [PATH:mel01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mel00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mel00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mel00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:mel00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2494907..2496580)
Genome map
AA seq 557 aa AA seqDB search
MSSLLNEFVSKTDFESYSDFEENFRINIPEEFNFSYDVVDKYAEMDPEKIAIVWCNDNDE
ERTFTFKDLKIYSDKAANLFRENGIVKGDTIMLTLKSRYEFWFCLLGLNKIGAIPIPATH
MLKSKDIVYRIESADIKMVVCIAEEGVPECVDEAEKRLKSNKIIKAVVGGNKEGWLDFKS
ELESQSSKFTRPTGDEATNLDDASVVYFSSGTTGLPKMIMHDFTYPLGHIITAKYWQNVI
DDGLHYTVADTGWAKCLWGKIYGQWIAGSAVFVYDYDRFDAAEMLEKASKHGVTTFCAPP
TIYRFLIKEDLSQYDFSTLKYAVTAGEPLNPEVYNKFYEFTGLRLMEGFGQTETVISIGN
FTWTEPRPGSMGKPSPGYNIQLMDKKGKIVDVGEEGEIVIGTKDGKPPGLFSGYYKDKKN
TKKAWHDDYYHTGDTAWKDEDGYLWFVGRNDDIIKSSGYRIGPFEVESAVISHPSVLECA
ITGVPDPVRGQVVKATIVLAKGYEPSEQLKKEIQNHVKAVTAPYKYPRVIEFVEELPKTI
SGKIRRIEIREKDEESK
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcgttactcaatgaattcgtttcaaaaactgattttgaatcatacagtgatttt
gaagaaaacttcaggataaacatacctgaagaatttaacttttcttacgatgtggttgac
aaatatgcagagatggatccagaaaaaattgccattgtatggtgcaacgacaacgatgag
gaaagaacattcacctttaaagacctgaaaatttacagtgacaaggctgcaaatctgttc
agggaaaacggaattgttaaaggtgacactatcatgctcacattaaaaagcaggtatgaa
ttttggttctgtcttttgggacttaacaaaataggagctataccaattccagcaacccac
atgctgaaatctaaggatattgtgtacaggatagaaagtgcagatatcaagatggtggta
tgtatagcagaagaaggagtgccagaatgtgttgatgaagctgaaaaacgtcttaaatca
aacaaaatcattaaagcagttgttgggggaaataaagagggatggttagatttcaagtca
gaacttgaatctcaatcctctaaatttacaagaccaactggtgatgaagcaacaaacctc
gatgatgcttcagtggtttacttctcatcaggaacaacaggacttccaaaaatgatcatg
catgatttcacctatccacttggacacataataactgccaagtactggcaaaatgtaatt
gacgacggtttgcactacactgttgcagacacaggttgggctaagtgtctatggggaaaa
atttacggacagtggatagcaggcagtgcagtatttgtctacgattacgatcgttttgat
gctgctgaaatgcttgaaaaagcatcaaaacacggcgtcaccaccttctgtgctcctcca
acaatttacagattcctgatcaaggaagatctatcccaatatgatttctccacgttgaag
tacgctgtcacagcgggagaaccattaaaccctgaagtttacaacaaattttatgaattc
acaggattaagattaatggaaggttttggacagacagaaacagtgatcagcataggaaat
ttcacatggacagaaccaagaccaggatcaatgggcaaaccatcaccaggatacaacatt
caattgatggataagaagggcaaaattgtcgatgttggagaggaaggagaaattgtcata
ggaaccaaggatggaaagcctccagggctattttcaggatattataaggataagaaaaat
accaaaaaagcatggcacgatgattactaccacactggagacacggcatggaaggatgaa
gatggatacctatggttcgttggaagaaatgatgatattatcaagagttcagggtacaga
ataggtccatttgaagtggaaagtgctgttatttcacacccctctgttttggagtgtgcg
attacaggagtcccagatccagttaggggccaggttgttaaagccacaattgttttggcc
aagggctacgagccatctgaacagcttaaaaaggaaatccaaaaccatgttaaggcagtt
acagcaccatacaagtatcctagggtgattgagttcgttgaagaactcccaaaaacaata
agcggcaaaataaggcgtattgaaataagagaaaaggatgaagaaagcaagtag

DBGET integrated database retrieval system