KEGG   Methanobacterium lacus: Metbo_2461Help
Entry
Metbo_2461        CDS       T01437                                 

Definition
phosphoglucosamine mutase (EC:5.4.2.10)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mel  Methanobacterium lacus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mel00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metbo_2461
   00030 Pentose phosphate pathway
    Metbo_2461
   00051 Fructose and mannose metabolism
    Metbo_2461
   00052 Galactose metabolism
    Metbo_2461
   00500 Starch and sucrose metabolism
    Metbo_2461
   00520 Amino sugar and nucleotide sugar metabolism
    Metbo_2461
  Nucleotide metabolism
   00230 Purine metabolism
    Metbo_2461
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Metbo_2461
Enzymes [BR:mel01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Metbo_2461
    5.4.2.8  phosphomannomutase
     Metbo_2461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2499318..2500670)
Genome map
AA seq 450 aa AA seqDB search
MTIKRLFGTFGVRRIANQELTPEFASRLAAAYGSIVKGTVAVGGDPRTSTEMIKHAVIAG
LLSAGCKVIDLGILPTPAVQFAVRNYYDGGVMITASHNPPKYNGLKFVDSDGIGIEEKWE
QKIEAMFFDEEPVRVSWNAIEESTKNHGIVEEYIENVIERVDSQAIKEANLKVIVDCGSG
AACFTTPYLLRRLGCQVTTMNCQPDGFFPGRNPEPTSENLEELKNVVKATGADLGIAHDG
DADRTICIDENGEFVFGDKTFALVEKAMLKENGGGTIVTTVATSAAIYDIAEEYNGEVIA
TRVGDLLVARELKDQNGLFGGEENGGLIFPEFVYGRDAALSTAKIVEIMAKEAKPLSELI
QELPKYCSAKLKVECADHQKSTVMDRIVEATSDHEVDTKDGVKILTEKGWVIIRPSGTEP
IFRCFAEAQTEEDALKMAKWGISLVEENME
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgacaattaaacgattatttggaacatttggagttaggagaattgctaatcaagaatta
acaccagaatttgcttcaagacttgcagcagcatatggatctattgttaagggaacagtg
gctgttggaggcgatccaagaacatctacagaaatgatcaaacatgcagtgattgcagga
cttttatcagcaggatgtaaggtcatagatcttggaattttacctactcccgcagttcag
tttgcagttagaaactattatgatggaggggtaatgataacagcatcacacaaccctcca
aaatataatggacttaaatttgttgattctgatggaataggaatcgaagagaaatgggaa
caaaaaattgaggcaatgttcttcgatgaggaacctgtaagggtttcttggaatgctatt
gaagaatcaactaagaatcatggtattgttgaggagtacatcgaaaatgtcatcgaaagg
gtggactcccaggcaattaaagaggccaatctcaaggtaatagttgattgtggaagtgga
gcagcatgtttcacaactccctacttgttgagaaggttagggtgccaggtaactacaatg
aactgtcaaccagatggatttttccctggaagaaatccagaaccaacatctgaaaacttg
gaagaactgaaaaatgttgttaaagccacaggggcagatcttggtatagctcatgatgga
gatgcagataggaccatatgcatcgatgaaaatggagaatttgttttcggggacaaaaca
tttgcactggttgaaaaggcaatgctcaaggaaaatggaggcggaactatagtaacaact
gttgctacttctgctgcaatatatgacattgctgaggaatataatggagaagttatagcc
accagggtgggtgatcttctggttgcaagggaactgaaggatcaaaatggacttttcgga
ggagaagaaaatggaggactcatcttcccagaatttgtatatggaagggatgcagctctg
tccacagctaaaatagttgaaatcatggcaaaagaagctaaacctctgtctgaactcatt
caagaacttcctaaatactgttctgcaaagttgaaggttgaatgtgcagaccatcagaaa
tcgactgtaatggacaggatcgttgaagcaacctcagatcatgaagtggataccaaagat
ggagttaaaatattaacagaaaaaggatgggtaattatcagaccatctggaaccgagcca
atattccgctgttttgcagaagctcaaacagaagaagatgcattaaaaatggctaaatgg
ggcatatctttggttgaagaaaatatggagtga

DBGET integrated database retrieval system