KEGG   Methanobacterium sp. AL-21: Metbo_2514Help
Entry
Metbo_2514        CDS       T01437                                 

Definition
helix-turn-helix domain-containing protein
Orthology
K00204  
4Fe-4S ferredoxin
Organism
mel  Methanobacterium lacus
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, CO2 => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metbo_2514
  Energy metabolism
   00680 Methane metabolism
    Metbo_2514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2557833..2558282)
Genome map
AA seq 149 aa AA seqDB search
MPKHIASGLKYLAALELVRDGYSQKQISKMLNVNKSTLSHYLNGRNISLGSIEIAEIVRE
FSPRDFLVFTDAIIEDKEATKTIVKTCLVNKYSVEVKDSCIGCGICVDTCLIDAIVLDDL
KAHIDSDICCGCQICAEKCPTNSINILEE
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaacacatagcttctggattgaaatatttagcggctttagaactcgttagagac
ggttacagtcaaaaacagatttcgaaaatgctaaatgttaataaatccacgctttctcat
tatttaaatggtagaaacatttctttaggatcaatagagatagctgaaatcgtcagagag
ttctcaccacgagattttctggtttttactgacgccatcattgaagacaaggaagcaacg
aaaaccatagtgaaaacttgtttggtcaacaagtacagtgtcgaagttaaagattcttgc
attggttgtggaatttgtgtagatacatgtttgatagatgccatagttttggatgatcta
aaggcacacatagattctgatatctgttgtggatgtcaaatttgtgctgaaaaatgtcct
actaattcaattaatattttggaggaataa

DBGET integrated database retrieval system