KEGG   Methanoculleus marisnigri: Memar_0039Help
Entry
Memar_0039        CDS       T00477                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mem  Methanoculleus marisnigri
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mem01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mem00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mem00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mem00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:mem00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(32489..34378)
Genome map
AA seq 629 aa AA seqDB search
MAETFAVKLEEKCYYPDPRCKATAWTPDYTRAYSEFLRDPEGFWDRVARELDWFEPWDRV
REWNYPYAKWFINGKLNITTSCLDRHVAGGRKDKPAIVWHGESGEKRILSYEALHREVMR
FANGLSSLGVEKGDRVCIYMPLVPEQVVAMLACARIGAVHSVVFGGFGPDALAMRINDAK
AKVLVTADVGYRRGKTVPLRELASEALAHAPGVERVVVLRRETPAVELDPDREVDYADLM
ARAAPDCPAEPMDSEDPLFILYTSGSTGAPKGIVHTCGGYAVGTYYTTRHVFDVKENDVY
WCTADTGWITGHSYIVYGPLEVGTTVVLAEGTPDYPDPGAYWRLVQDLGVTIFYTAPTAI
RMFMRVGEEWPAKYDLSTLRVLGSVGEPLNPEAFEWYYRAIGGGRCPIVDTWWQTETGMH
MVTTMIGEAMKPGFAGKPIPGAVVDVVDRTGKPVPPGTGGFLVIREPWPAMLRTVHGNDE
RYCAYWNTIPGCYTAGDLAVKDEDGYIMVLGRADDLIVVAGHNIGTAEVESALVSHDAVA
EAAVIGKPDPLKGNVIKAFVTLCVGVSPGDGLTDDLARHVRKSLGPVAVPAEIEFMDRLP
KTRSGKIMRRVLKARELGMDPGDISTLEE
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaacattcgccgtgaaactggaagagaagtgctactaccccgatccccggtgc
aaggcgaccgcctggacgccggactacacgcgggcctacagcgagttcctgcgcgacccg
gaagggttctgggaccgggtcgcccgcgagctcgactggttcgagccctgggaccgggtc
agggagtggaactacccctatgcgaaatggttcatcaacggaaaactgaacatcaccacg
agctgcctggaccgccacgtcgccgggggccgtaaggataagccggcgatcgtctggcac
ggggagagcggagagaagcggatcctgtcctacgaggccctgcaccgcgaggtgatgcgg
tttgcaaacggcctctcgagcctcggggtcgagaagggcgaccgcgtctgcatctacatg
ccgctcgtccccgagcaggtcgtcgcgatgctcgcctgcgcccggatcggggccgtccac
tcggtggtcttcggtgggttcgggccggacgcgctcgcgatgcggatcaacgacgcgaag
gcgaaggttctcgtcaccgcagacgtcggttaccgccggggaaagaccgtcccgctccgc
gaactcgcgagcgaggcgctcgcccatgcgccgggcgtcgagcgggtcgtcgtcctccgg
cgcgagacgccggccgtcgaactcgaccccgaccgggaggtcgattacgccgacctgatg
gcccgtgccgcacccgactgcccggcggagccgatggactcggaagacccgctcttcatc
ctctacacgagcggttcgaccggcgccccgaagggcatcgtgcacacctgcggcgggtat
gcggtcggaacctactacaccacccgccacgtcttcgacgtcaaggagaacgacgtctac
tggtgcaccgccgacaccggctggatcaccggccacagttacatcgtctacggcccgctc
gaggtcggcacgaccgtcgtcctcgccgaagggacgccggactaccccgaccccggcgcc
tactggcggctggtccaggatctgggggtgacgatcttctacaccgccccgaccgccatc
cggatgttcatgcgggtgggcgaagagtggccggcgaaatacgacctctcgacgctccgg
gtgctcggctcggtcggcgaaccgctcaaccccgaggcattcgagtggtactaccgcgcg
atcggcggcgggcggtgcccgatcgtggatacatggtggcagaccgagaccgggatgcac
atggtgaccacgatgatcggcgaggcgatgaaaccggggtttgccggaaagcccatcccg
ggcgccgtcgtggacgtcgtcgacaggacggggaaacccgttccgcccggcaccggcggg
ttcctggtgatccgggagccctggccggccatgctccggacggttcacggtaacgacgag
cgctactgcgcctactggaacaccatcccggggtgctacaccgcaggcgacctcgcggtg
aaggacgaggatggctacatcatggtcctcggccgggccgacgacctgatcgtcgtcgcc
gggcacaacatcgggacggccgaggtcgagagcgccctcgtctcccacgacgcggtggcg
gaggcggcggtcatcgggaaacccgatcccctgaaagggaacgtcatcaaggcgttcgtc
accctctgcgtgggggtgagccccggcgacggcctcaccgacgacctcgcccggcacgtc
agaaagagcctcggcccggtcgcggttccggccgagatcgagttcatggaccggctcccc
aagacccggagcggcaagatcatgcgccgggtcttgaaagcccgcgagctcggcatggac
ccgggcgacatctcaacgctcgaggagtag

DBGET integrated database retrieval system