KEGG   Methanoculleus marisnigri: Memar_0074Help
Entry
Memar_0074        CDS       T00477                                 

Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mem  Methanoculleus marisnigri
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mem00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Memar_0074
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Memar_0074
Enzymes [BR:mem01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Memar_0074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
69444..70199
Genome map
AA seq 251 aa AA seqDB search
MILDDIVRSTRERLRDLDQSVVDPDPLPRRSLAAAIRTSSERHAVIAEVKYASPSRGRIH
EGCTPEAIAREFVAAGAAGLSVLTEPTYFSGSIENLARVRRAVSVPVLRKDFIVDERQLG
ETRALGADAVLLIARVLGNRLPAFVDSALALGLEPLVEVHDRDEMERALATNATLIGINN
RNLATMTIDLSTTVRLAGAARDAGRVVVSESGIMWPYDVRSLSRHCDAFLIGSALMSARD
RRKRLEGFVFA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcgacgatatcgtcaggtcgacccgcgagcgcctccgggatctcgatcaatcg
gtcgtcgatcccgatcccctgccccgccggagcctcgcagcggcgatacgcacctcttcc
gagaggcacgcggtcatcgccgaggtgaagtacgcctccccgtcgcgggggaggatccac
gaaggctgcacgcctgaggcgatcgcccgggagttcgtcgccgccggggccgccggcctc
tcggtgctgaccgaacccacctacttttcggggagtatcgagaacctcgccagggtgcgg
cgtgcggtctctgtcccggttctccgcaaagacttcatcgtcgacgaacgccagctcggc
gagacccgggcgctcggcgccgacgccgtcctcctgatcgcccgggtgctcgggaaccgc
ctccccgcgttcgttgattcggcgctcgcgctcgggctcgagccgctcgtcgaggttcac
gatagggacgagatggagcgtgctcttgcgacgaatgcgaccctcatcgggatcaacaac
cgtaacctcgcgacgatgacgatcgatctctcgacgaccgtccgcctggcgggggcggca
cgcgatgcggggagggttgtggtctcggagagcggcatcatgtggccctacgacgtgcgg
agcctctcccggcactgcgacgcgttcctgatcgggtccgccctgatgtcggcccgcgac
cggcgcaaacgactggaggggttcgtattcgcgtga

DBGET integrated database retrieval system