KEGG   Methanoculleus marisnigri: Memar_0076Help
Entry
Memar_0076        CDS       T00477                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mem  Methanoculleus marisnigri
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mem00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Memar_0076
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Memar_0076
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Memar_0076
Enzymes [BR:mem01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Memar_0076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
70768..71940
Genome map
AA seq 390 aa AA seqDB search
MKAGRYGVYGGQYVPETLMSALIELEETYGRIREDPGFSRRLSWYLREYAGRETPLTYCG
NLSRDLGCRVYLKREDLLHGGAHKLNNTLGQALMAKFMGKRRLIAETGAGQHGVATAIAG
AALGLPVEVYMGEVDTRRQALNVFRMELLGARVVPVASGTRTLKDAINAAMRDWVANLRE
THYLLGSCVGPHPFPRIVRDFQSVIGEETRRQILEREGRLPDTVVACVGGGSNAIGIFYP
FVGDDVALVGVEAGGEGLDSGRHGASLSAGSVGVFQGALSYLLQDGDGQALETHSVAAGL
DHPSVGPEHAMLKDSGRVRYEAVTDAEALHAFRRLSRTEGIIPALESAHAVAYALRAADD
LDKDGILVVNLSGRGDKDVADVANLHGGVA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaggacgatacggagtatacggcgggcagtacgtgcccgagaccctgatgagc
gcgctgatcgagctggaggagacctatgggcgaatccgcgaggacccgggattctcccgc
cggctctcctggtacctccgcgagtacgccgggcgggagacgccgctcacctactgcggg
aacctctcccgtgacctcggctgccgggtttacctgaaacgtgaggatctcctccacggc
ggtgcgcacaagctgaacaacaccctcggccaggcactcatggcgaagttcatgggcaag
cgccggctgatcgccgagacgggcgccgggcagcacggcgttgcgacggcgatcgcgggc
gcggcgctcggtctgcccgtcgaggtctacatgggcgaggtggatacccggcgccaggca
ttgaatgtctttcggatggaactcctcggcgcccgggtcgtcccggtcgcctccgggacg
cggacattgaaggacgccatcaacgcggcgatgcgcgactgggtggcgaacctccgggag
acccactacctgctcggctcctgcgtcggcccgcaccccttcccccggatcgtccgcgac
tttcagtcggtgatcggcgaggagacgagaaggcagatccttgaacgggaagggcggctc
cccgacaccgtcgtcgcctgcgtcggcgggggttcgaacgcgatcggcatcttctacccg
ttcgtcggcgacgacgttgcactggtcggcgtggaagcgggaggcgaggggctcgattcc
ggccgtcacggcgcttcgctctctgccggttcggtcggggtctttcagggggcgctctcc
taccttctccaggacggcgacggccaggcgctcgagacgcactccgtcgccgcgggcctc
gaccacccctcggtcgggccggagcacgccatgctgaaggactccgggcgggtccgctac
gaggcggtcaccgacgcagaggcgctccacgccttccgccgtctctcccgcaccgagggg
atcatcccggcgctcgagtccgcccacgcggtcgcctacgctctccgggcggcggacgat
ctcgataaggacggcatcctcgtcgtcaacctctcggggaggggggacaaggatgttgcc
gacgtcgcgaaccttcacgggggcgttgcatga

DBGET integrated database retrieval system