KEGG   Methanoculleus marisnigri: Memar_0077Help
Entry
Memar_0077        CDS       T00477                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mem  Methanoculleus marisnigri
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mem00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Memar_0077 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Memar_0077 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Memar_0077 (trpA)
Enzymes [BR:mem01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Memar_0077 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
71937..72749
Genome map
AA seq 270 aa AA seqDB search
MSRIDALFARSPAFIGFTVAGDPGIEASLRVAKAMIEAGVDLLEIAIPYSDPVADGPVIE
RAHVRALRAGTTTDDVFALVRRIREHAPALPLVLFTYHNIIHRRGPDRFFSEAAAAGADG
VLIVDLPVEESGEVAPCAARYGIDRIALIAPTTSPERQHAILSGASGFVYLISLEGVTGE
RDRLPPGIAGLVGAVREKTGLPLAVGFGVSRPEHVRTVVAAGANGVIVGSALVRLIEEHA
GDEAGMQDALRAAIAALRRGLVPDPEPDIP
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgagccggatcgacgccctctttgcccggagcccggccttcatcgggttcaccgttgcc
ggagaccccggcatcgaggcttcgctccgggtggcgaaggcgatgatcgaagcgggcgtg
gacctcctcgagatcgcgatcccctactccgatccggtggcggacggtcccgtgatcgaa
cgggcgcacgtccgtgccctccgggcggggacgaccacggacgacgtcttcgcccttgtc
cggcgcatccgggagcacgcgccggcgctccccctcgtcctcttcacctaccataacatc
atccaccgccgggggccggaccggttcttttcggaggccgcggccgccggcgcggacggc
gttctcatcgtcgacctccccgtcgaggagtcgggcgaggtcgcgccctgcgccgcccga
tacggcatcgaccggatcgccctcatcgccccgacgacgtcgccggagcggcagcatgcg
atcctttccggagcatccgggttcgtctacctgatctcgctcgagggggtgaccggcgag
cgcgaccgcctcccccccggtatcgccgggctggtcggcgcggtgcgggagaagaccggt
cttcctctcgccgtcgggttcggggtctcgcgcccggaacacgtccggaccgtcgtcgcc
gccggcgcgaacggcgtcatcgtggggagcgcgctcgtccggctgatcgaggagcacgcg
ggcgacgaggccgggatgcaggatgccctccgggcggcgatagccgccctccggcgcggg
ctcgtccccgaccccgaacctgatataccctga

DBGET integrated database retrieval system