KEGG   Methanoculleus marisnigri: Memar_0077Help
Entry
Memar_0077        CDS       T00477                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mem  Methanoculleus marisnigri
Pathway
mem00260  Glycine, serine and threonine metabolism
mem00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mem01100  Metabolic pathways
mem01110  Biosynthesis of secondary metabolites
mem01130  Biosynthesis of antibiotics
mem01230  Biosynthesis of amino acids
Module
mem_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mem00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Memar_0077
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Memar_0077
Enzymes [BR:mem01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Memar_0077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth ThiG PA NanE IGPS NMO IMPDH
Motif
Other DBs
NCBI-ProteinID: ABN56012
UniProt: A3CRL2
Position
71937..72749
Genome map
AA seq 270 aa AA seqDB search
MSRIDALFARSPAFIGFTVAGDPGIEASLRVAKAMIEAGVDLLEIAIPYSDPVADGPVIE
RAHVRALRAGTTTDDVFALVRRIREHAPALPLVLFTYHNIIHRRGPDRFFSEAAAAGADG
VLIVDLPVEESGEVAPCAARYGIDRIALIAPTTSPERQHAILSGASGFVYLISLEGVTGE
RDRLPPGIAGLVGAVREKTGLPLAVGFGVSRPEHVRTVVAAGANGVIVGSALVRLIEEHA
GDEAGMQDALRAAIAALRRGLVPDPEPDIP
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgagccggatcgacgccctctttgcccggagcccggccttcatcgggttcaccgttgcc
ggagaccccggcatcgaggcttcgctccgggtggcgaaggcgatgatcgaagcgggcgtg
gacctcctcgagatcgcgatcccctactccgatccggtggcggacggtcccgtgatcgaa
cgggcgcacgtccgtgccctccgggcggggacgaccacggacgacgtcttcgcccttgtc
cggcgcatccgggagcacgcgccggcgctccccctcgtcctcttcacctaccataacatc
atccaccgccgggggccggaccggttcttttcggaggccgcggccgccggcgcggacggc
gttctcatcgtcgacctccccgtcgaggagtcgggcgaggtcgcgccctgcgccgcccga
tacggcatcgaccggatcgccctcatcgccccgacgacgtcgccggagcggcagcatgcg
atcctttccggagcatccgggttcgtctacctgatctcgctcgagggggtgaccggcgag
cgcgaccgcctcccccccggtatcgccgggctggtcggcgcggtgcgggagaagaccggt
cttcctctcgccgtcgggttcggggtctcgcgcccggaacacgtccggaccgtcgtcgcc
gccggcgcgaacggcgtcatcgtggggagcgcgctcgtccggctgatcgaggagcacgcg
ggcgacgaggccgggatgcaggatgccctccgggcggcgatagccgccctccggcgcggg
ctcgtccccgaccccgaacctgatataccctga

DBGET integrated database retrieval system