KEGG   Methanoculleus marisnigri: Memar_0551Help
Entry
Memar_0551        CDS       T00477                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K18931  
AMP phosphorylase [EC:2.4.2.57]
Organism
mem  Methanoculleus marisnigri
Brite
Enzymes [BR:mem01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.57  AMP phosphorylase
     Memar_0551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
532337..533860
Genome map
AA seq 507 aa AA seqDB search
MKLTVKLLDIENRGVLLHCTDARSMRVRDGDRVQIVDEATGKTAQAHVDTTGSLIEPGVI
GVYRPVNATLAVDEGTPVEVRGAERPASLEHIKKKMDGGRFTKDDTVDIVRDIVDDVLSP
GEITAYVTASYINGLDMDEVEYLTRATVETGERLHFTRHPIVDKHSIGGVPGNKITLLIA
PIIAASGLLIPKTSSRAITGAGGTADLMEVLAPVSFPALEVQQMTEKVGGAIVWGGATNI
APADDKIITYEYPLRIDARGQMIASVMAKKFAVGADLVVIDIPVGRNTKIATAQEGRKLA
REFIDLGERLGMRVECALSYGESLVGHTIGPNLEVREALAVLEGATEPNSLIQKSLSLAG
IALEMAGKAGPGQGARAAADILRSGKALEKMRQIIEIQGGDPNVKAEDIVPGECRFDVNA
PQDGYVIELNNSALVTLARLAGSPYDHGAGLLVHAKKGTRVRKGDPIFTIYADREWRLER
AIEVGRTLMPVLVEGMVLERIPHERWV
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgactgtgaaactgctcgacatcgaaaaccggggggttctcctccactgcacc
gatgcacggagcatgcgggttcgcgacggcgaccgcgtccagatcgtcgacgaagcgacc
ggaaagactgcccaggctcacgtcgacaccaccggttcgctcatcgagccgggcgtcata
ggcgtctaccggccggtgaacgccacgctcgccgtcgacgagggaactcccgtcgaggtc
cgcggcgccgagcggccggcatcccttgagcacatcaagaagaagatggacggcggccgg
ttcaccaaagacgataccgtggatatcgtcagggacatcgtcgacgacgtcctctcgccc
ggcgagatcaccgcttacgtcaccgcttcctacatcaacggcctcgacatggacgaggtg
gagtacctgacgagggccacggtcgagaccggagaacgcctccacttcacccggcacccc
atcgtcgacaaacactccatcggaggtgtcccgggaaacaaaatcacgctcctgatcgcc
ccgatcatcgccgcgagcggtcttttgatccccaagaccagctcccgcgccatcaccggc
gcagggggaaccgcggatctcatggaagtcctcgcgcccgtctcgttcccggcgctcgag
gtgcagcagatgaccgagaaggtcggcggcgccatcgtctggggcggtgccacgaacatc
gcccccgccgacgacaagatcatcacttatgaatacccactccggatcgacgcccgtggc
cagatgatcgcgagcgtcatggcaaagaagttcgccgtcggcgccgacctcgtggtcatc
gatattccggtcggccggaacaccaagatcgcgactgcccaggagggacggaaactcgcc
cgggagttcatcgatctcggggaacggctcgggatgcgggtcgagtgtgcgttaagctac
ggggagtcgctcgtcggccacaccatcggcccgaacctcgaggtgcgcgaggcgctcgcc
gtcctcgagggggcgaccgagccgaactccctgatccagaagagcctctccctcgccggg
atcgcgctcgagatggccgggaaggccgggccggggcagggtgcccgggcggccgccgat
atcctccggagcggcaaggcgctcgagaagatgcggcagatcatcgagatccagggtggt
gatccgaacgtaaaggccgaggatatcgttccgggagagtgcaggttcgatgtaaatgcg
ccgcaggatggttacgtcatcgaactgaacaacagcgctctcgtcacgctcgcccggctc
gccggttcgccctatgaccacggcgcgggcctgctcgtccacgcaaagaaaggaacccgg
gtccggaaaggcgatcccatcttcaccatctacgccgaccgcgaatggcggctcgagcgt
gcgatcgaggtcggccggacgctgatgccggtgcttgtggaaggtatggtacttgaacgt
atccctcatgaacggtgggtgtaa

DBGET integrated database retrieval system