KEGG   Methanoculleus marisnigri: Memar_0707Help
Entry
Memar_0707        CDS       T00477                                 

Definition
pyruvate/ketoisovalerate oxidoreductase, gamma subunit (EC:1.2.7.1)
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
mem  Methanoculleus marisnigri
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mem00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Memar_0707
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Memar_0707
   00020 Citrate cycle (TCA cycle)
    Memar_0707
   00620 Pyruvate metabolism
    Memar_0707
   00640 Propanoate metabolism
    Memar_0707
   00650 Butanoate metabolism
    Memar_0707
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Memar_0707
   00680 Methane metabolism
    Memar_0707
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Memar_0707
Enzymes [BR:mem01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Memar_0707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
688923..689468
Genome map
AA seq 181 aa AA seqDB search
MRELRIHGRGGQGSVTAAELIAYAAFEGGVFSQAFPAFGVERRGAPVQAFVRFSDEKVRL
RSQIYEPDYIIVQDPTLIGDVDVFNGMKAGGIAIINTEKSDFDSGVPEGVKVYTIDATTI
ALEELGVPITNTTLMGAFAAATGEIGLEPLEHALRSRFSGSMADKNVRAAERAYNLIGGA
A
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
ttgagagagttacgcattcacggcaggggtggtcagggttccgtgaccgccgccgaactc
attgcttacgcagcattcgagggcggtgttttttcccaggcattcccggccttcggtgtg
gaacgccggggcgccccggttcaggcgttcgtccggttcagcgacgagaaggtacggctg
cgcagccagatctatgagcccgattacatcatcgtgcaggaccctaccctgatcggggat
gtcgacgtctttaacggtatgaaagcgggtgggatcgccatcatcaacaccgagaagtcc
gacttcgattccggtgttccggagggcgtgaaggtctacaccatcgatgcgaccaccatc
gcgctcgaagagctcggtgtgcccatcaccaatacaaccctgatgggcgcgttcgccgca
gccaccggagagatcgggcttgagccgcttgagcacgcgctgcgaagccggttttccggg
agcatggccgacaaaaacgtcagggcggcagagcgcgcgtacaacctgatcggaggtgcc
gcataa

DBGET integrated database retrieval system