KEGG   Methanoculleus marisnigri: Memar_0709Help
Entry
Memar_0709        CDS       T00477                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
mem  Methanoculleus marisnigri
Pathway
mem00010  Glycolysis / Gluconeogenesis
mem00020  Citrate cycle (TCA cycle)
mem00620  Pyruvate metabolism
mem00640  Propanoate metabolism
mem00650  Butanoate metabolism
mem00680  Methane metabolism
mem00720  Carbon fixation pathways in prokaryotes
mem01100  Metabolic pathways
mem01120  Microbial metabolism in diverse environments
mem01130  Biosynthesis of antibiotics
mem01200  Carbon metabolism
Module
mem_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mem_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mem00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Memar_0709
   00020 Citrate cycle (TCA cycle)
    Memar_0709
   00620 Pyruvate metabolism
    Memar_0709
   00640 Propanoate metabolism
    Memar_0709
   00650 Butanoate metabolism
    Memar_0709
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Memar_0709
   00680 Methane metabolism
    Memar_0709
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Memar_0709
Enzymes [BR:mem01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Memar_0709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ABN56642
UniProt: A3CTE2
Position
689728..690882
Genome map
AA seq 384 aa AA seqDB search
MLEFMEGSHAVAEIVKRCRPQVISAYPITPQTHIVEDLAQMVANCEIDAEYITVESEFSA
LSACLGASAAGSRVYSATTSQGLALMFEVCFNVAGMRQPIVMTIANRSLGAPLSIWNDQQ
DSISLRDSGWLQFYAEDNQETADLHMIAYKVCEDHDILLPAFVCFDGFILTHTFEPVSLP
TQEEVDAYLPAFTPYQRLDAANPLSFGMYATPEYYMEFRYEVDRAMQRAKDAFVKAGREF
GEQFGRDYSALVEGYRLEDADTALVAMGSICGTVKDAVDEMREHGRKVGLLKIRTYRPFP
AQEIADALKGVSTVAVLDKNISLGNGGAVGTEVKAALYGSGISIYDYIIALGGRDVRKRD
IAAIVDLAEKGKGDMFYGLRTEVL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgctggagtttatggaaggatcgcatgcggtggccgagatcgtaaagcgctgccgcccg
caggtgatctcagcctaccccatcacgccacagacgcacatcgtcgaagaccttgcccag
atggtggcgaactgcgagatcgatgccgagtatatcacggtcgagagcgagttctcggcc
ctttccgcctgcctcggtgcgagtgcggcgggttcccgggtctattcggcgacgacgtcc
caggggcttgccctgatgttcgaggtctgcttcaacgtggcggggatgcgccagccgatc
gtgatgacgatcgcgaaccggtctctcggtgcgccgctctcgatctggaacgaccagcag
gactcgatatccctgcgcgattccgggtggctgcagttctacgcggaggacaaccaggag
accgccgatctccacatgatcgcctacaaagtctgtgaggatcacgacatcctcctcccg
gcgtttgtctgcttcgacgggttcatcctcacgcacaccttcgagccggtctccctcccc
acccaggaggaggtggatgcctacctgccggccttcacgccgtaccagcggctggacgcc
gcaaacccgttgagtttcgggatgtacgcgacgcccgagtactacatggagttccggtac
gaagtcgaccgggcgatgcagcgtgcgaaagatgcgttcgtcaaagccgggcgtgagttc
ggcgagcagttcggcagggactactccgcgctcgtcgagggctaccggctcgaggacgcc
gataccgcgctcgtcgccatgggctccatctgcggcaccgtaaaggacgccgtcgacgag
atgcgcgagcacgggcgaaaggtcgggctcttaaagatccggacctaccggccgtttccg
gctcaggagatcgcggatgccttgaagggcgtctcgacggtcgcggtgctcgacaagaac
atctcgctcggcaacggcggggctgtcggcaccgaggtgaaagcggcgctctatggttcc
ggcatatccatttacgattacatcattgccctcggcgggcgcgacgtgcggaagagggat
atcgccgcgatcgtcgatctcgccgagaaggggaaaggagatatgttctatggattacgg
acggaggtgctctga

DBGET integrated database retrieval system