KEGG   Methanoculleus marisnigri: Memar_0710Help
Entry
Memar_0710        CDS       T00477                                 

Definition
thiamine pyrophosphate binding domain-containing protein
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
mem  Methanoculleus marisnigri
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mem00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Memar_0710
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Memar_0710
   00020 Citrate cycle (TCA cycle)
    Memar_0710
   00620 Pyruvate metabolism
    Memar_0710
   00640 Propanoate metabolism
    Memar_0710
   00650 Butanoate metabolism
    Memar_0710
  Energy metabolism
   00680 Methane metabolism
    Memar_0710
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Memar_0710
Enzymes [BR:mem01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Memar_0710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
690883..691791
Genome map
AA seq 302 aa AA seqDB search
MAEVEQECELFSAGHRACGGCGPALAARLLLKATGKNAILVASTGCMEVFSTPYPETAWG
VPWIHSLFENAAAVASGIEASLKRQGRSEKVLCVCGDGATFDIGVLCISGAFERGHDITY
ICYDNEAYMNTGIQRSGATPYGASTTTSPAGKCSPGNVHPKKDMPAILAAHGAPYVATAS
IAYPNDFIKKVERAINTPGPCYIQVHTPCCTGWGFEAGETLNMGKLAIETGLWVNYELVN
GQVEKVKKVRRKPVEEYLTKQKRFRHLFKPARQDDMIASIQAIADVNAERFGVDIKQKES
SE
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagtagagcaggaatgtgaactcttctcggccgggcaccgggcgtgcggaggg
tgcggcccggcgcttgcggctcgccttctcctcaaggcaaccgggaagaacgccatcctg
gtagcatcgaccggctgcatggaggtcttctccacgccctacccggagaccgcctgggga
gttccctggatccattcgctcttcgagaacgccgcggcggttgcctccggcatcgaggct
tcgttgaagaggcaggggcgcagcgagaaggtcctctgcgtctgcggcgacggagccacg
ttcgatatcggagtgctctgcatcagcggcgctttcgagcggggccacgacatcacctac
atctgctacgacaacgaggcctacatgaacacgggcatccagcggtcgggcgcgacgccg
tacggcgcgagcaccacgacgagcccggcaggcaagtgctcgcctgggaatgtgcacccg
aagaaggacatgcccgcgatcctcgccgcacacggtgcgccgtacgtcgcgaccgcctcg
atcgcctacccgaacgacttcataaagaaggtcgagcgggcgatcaacacccccggcccc
tgctatatccaggtgcacactccctgctgcacgggatggggctttgaggccggcgagacg
cttaacatgggcaagctcgccatcgagacaggcctctgggtgaactacgagctggtcaac
gggcaggtcgaaaaggtgaagaaggtgcgacggaaaccggtcgaggagtatctcacaaag
cagaagcgcttccggcacctcttcaagcctgcccggcaggatgacatgatcgcgagcatc
caggcgatcgccgatgtcaacgccgagcggttcggggttgacatcaagcaaaaagaatcg
tcagaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system