KEGG   Methanoculleus marisnigri: Memar_0713Help
Entry
Memar_0713        CDS       T00477                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mem  Methanoculleus marisnigri
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mem00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Memar_0713
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Memar_0713
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Memar_0713
Enzymes [BR:mem01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Memar_0713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(692892..694097)
Genome map
AA seq 401 aa AA seqDB search
MYRLVCVHCGATYSPDQIIYTCNRCGHLLTVEYDLDGIDVSRDEWNRRPLSVWRYRELLP
VRGEPVSLQEGGTPLYHLKNIGKELGLSELYAKHEGMNPTGSFKDRGMTVGVSMACELGM
TTVACASTGNTSASLAAYAAKGGIPCVVLLPAGKVALGKIAQALMHGARVISIRGNFDRA
LEMVHELCISHGLYLLNSVNPYRLEGQKTIGFETIDQLGGEVPDRMVLPVGNAGNISAVY
KGLRELETLGFIDRLPMMTGIQAAGSQPVVKAIEQNLEVLVPESAPETVATAIRIGAPVN
AEKALVAIRATGGTAAAVTDEEILAMQRDLARKEGIGVEPASAASVAGIRKLAELGLIDK
DERIVCVVTGHLLKDPETVVRQCEPPTEIDADLPSLLSALR
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgtctcgtctgcgttcattgtggtgcaacctactcaccggaccagatcatctat
acgtgcaaccgctgcggacacctgctgaccgtcgaatacgacctggacggcatcgacgtc
tcacgcgacgaatggaaccggcgccccctttcggtctggcgctaccgcgaactcctcccg
gttcggggcgaaccggtctccctccaggaaggagggaccccgctctaccacttaaagaac
atcggtaaggaactgggcctctccgaactctacgcaaaacacgaggggatgaacccaacc
ggttcgttcaaggaccgggggatgaccgtgggcgtcagcatggcctgcgaactcgggatg
acgacggtcgcctgcgcgagcaccgggaacacctccgcaagcctcgctgcctacgcggcg
aagggaggaattccgtgtgtcgtcctcctgcccgcggggaaggtcgccctcgggaagatt
gcccaggcgctgatgcacggtgcccgggtcatctctatccgcggcaacttcgatcgggcg
ctcgagatggtacacgagctctgcatcagccacggcctctacctcttgaactcggtcaat
ccctaccggcttgagggacagaagacgatcgggttcgagacgatcgaccagctcggcggc
gaggtgcccgaccggatggttctccccgtaggaaacgcgggcaacatctccgcagtctac
aaagggctccgggaactcgaaaccctcggattcatcgaccggttgccgatgatgaccggc
atccaggctgccggctcacagccggtggtgaaggcgattgagcagaacctcgaggtgctg
gttccggagtccgcgcccgagacggttgcgaccgcgatacggatcggcgccccggtgaat
gcggagaaggcgctcgtcgcgatccgcgcgacgggcgggacggcggcggccgtgaccgac
gaggagatccttgccatgcagcgggatctcgcgaggaaggaaggcatcggggtcgaaccc
gcctcggcagcctcggtcgccggaatacggaaacttgccgaactcggcctgatcgataaa
gatgagcggatcgtctgcgtggtgaccggtcatctcttaaaagatcctgaaacagtggta
cgacaatgcgagccccccaccgagatcgacgcggacctgccctcgctgctctctgccttg
cgctga

DBGET integrated database retrieval system