KEGG   Methanoculleus marisnigri: Memar_0859Help
Entry
Memar_0859        CDS       T00477                                 

Definition
(GenBank) cytidine kinase / inosine-guanosine kinase
  KO
K22026  
nucleoside kinase [EC:2.7.1.73 2.7.1.213 2.7.1.-]
Organism
mem  Methanoculleus marisnigri
Pathway
Purine metabolism
Pyrimidine metabolism
Brite
KEGG Orthology (KO) [BR:mem00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Memar_0859
   00240 Pyrimidine metabolism
    Memar_0859
Enzymes [BR:mem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.73  inosine kinase
     Memar_0859
    2.7.1.213  cytidine kinase
     Memar_0859
    2.7.1.-  
     Memar_0859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
835373..836263
Genome map
AA seq 296 aa AA seqDB search
MISVVGHTAVDHLFRVPKLPGRHNSTYITGHEVYFGGGAANIAAGIAMLGERCRLVSLVG
GDFPGSDYDRWLHSLEIVQDFTQVKDARTATAYVFTDDDGDQETFFEWGASTAFSRAEAP
ALDFVHMATADPDFNVRVAQKSKFASFDPGQDLLRYTRDQLEIILANIDILFSNNHEMDR
MCEMLGLERSALVASIPMTVTTRGAEGSILCVDGEEFHVPAVAVEAVDPTGAGDGYRAGF
LTAFRKGHAPLDCCRVGAVVSSFVVERPGTQTNLPDWERMLARYRKVFDEPGEIIV
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgatctcagtcgtcgggcataccgccgtcgaccatctcttccgggtgccgaaactcccc
gggcggcacaactcgacctacatcaccggtcacgaggtctacttcggcggcggggcggcg
aacatcgcggccgggattgcgatgctcggcgagcgatgccggctggtctctctggtcggc
ggcgacttcccgggcagcgactatgatcggtggctgcacagcctcgagatcgtgcaggac
ttcacccaggtgaaggatgcccggaccgcgaccgcgtacgtcttcaccgacgacgacggc
gaccaggagaccttcttcgagtggggcgcgtcgaccgcgttctcccgcgcggaggctccc
gctctcgacttcgtccacatggcgacggccgaccccgacttcaacgtccgggtggcccag
aagagcaaattcgcctctttcgacccggggcaggatctcctccgctacacccgtgatcag
ctcgagatcatcctcgcgaacatcgatatcctcttctcgaacaaccacgagatggaccgg
atgtgcgagatgctggggctggagcgctccgcactcgtcgcgtcgatcccgatgacggtc
acgacccggggggcggaggggagcatcctctgcgtggacggcgaggagttccacgtcccg
gccgtcgcggtcgaggccgtcgaccccaccggcgccggcgacggctaccgtgccgggttc
ctcacggcgttccggaagggccacgccccgctcgactgttgccgcgtcggcgcggtggtc
tcgtccttcgtcgtcgagcggccgggcacccagacgaacctccccgactgggagcggatg
cttgcccggtaccggaaggtctttgacgagcccggcgaaattattgtctga

DBGET integrated database retrieval system