KEGG   Methanoculleus marisnigri: Memar_0859Help
Entry
Memar_0859        CDS       T00477                                 

Definition
ribokinase-like domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mem  Methanoculleus marisnigri
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mem00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Memar_0859
Enzymes [BR:mem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Memar_0859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
835373..836263
Genome map
AA seq 296 aa AA seqDB search
MISVVGHTAVDHLFRVPKLPGRHNSTYITGHEVYFGGGAANIAAGIAMLGERCRLVSLVG
GDFPGSDYDRWLHSLEIVQDFTQVKDARTATAYVFTDDDGDQETFFEWGASTAFSRAEAP
ALDFVHMATADPDFNVRVAQKSKFASFDPGQDLLRYTRDQLEIILANIDILFSNNHEMDR
MCEMLGLERSALVASIPMTVTTRGAEGSILCVDGEEFHVPAVAVEAVDPTGAGDGYRAGF
LTAFRKGHAPLDCCRVGAVVSSFVVERPGTQTNLPDWERMLARYRKVFDEPGEIIV
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgatctcagtcgtcgggcataccgccgtcgaccatctcttccgggtgccgaaactcccc
gggcggcacaactcgacctacatcaccggtcacgaggtctacttcggcggcggggcggcg
aacatcgcggccgggattgcgatgctcggcgagcgatgccggctggtctctctggtcggc
ggcgacttcccgggcagcgactatgatcggtggctgcacagcctcgagatcgtgcaggac
ttcacccaggtgaaggatgcccggaccgcgaccgcgtacgtcttcaccgacgacgacggc
gaccaggagaccttcttcgagtggggcgcgtcgaccgcgttctcccgcgcggaggctccc
gctctcgacttcgtccacatggcgacggccgaccccgacttcaacgtccgggtggcccag
aagagcaaattcgcctctttcgacccggggcaggatctcctccgctacacccgtgatcag
ctcgagatcatcctcgcgaacatcgatatcctcttctcgaacaaccacgagatggaccgg
atgtgcgagatgctggggctggagcgctccgcactcgtcgcgtcgatcccgatgacggtc
acgacccggggggcggaggggagcatcctctgcgtggacggcgaggagttccacgtcccg
gccgtcgcggtcgaggccgtcgaccccaccggcgccggcgacggctaccgtgccgggttc
ctcacggcgttccggaagggccacgccccgctcgactgttgccgcgtcggcgcggtggtc
tcgtccttcgtcgtcgagcggccgggcacccagacgaacctccccgactgggagcggatg
cttgcccggtaccggaaggtctttgacgagcccggcgaaattattgtctga

DBGET integrated database retrieval system