KEGG   Methanoculleus marisnigri: Memar_0965Help
Entry
Memar_0965        CDS       T00477                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mem  Methanoculleus marisnigri
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mem00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Memar_0965
Enzymes [BR:mem01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Memar_0965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(949272..950123)
Genome map
AA seq 283 aa AA seqDB search
MHELAHLHFADADASYEDARYAVFGVPYDGTTSFRPGTRFGPRAIREVSFNFESYDPATK
IDFSEVPITDLGDLAVSRLPEEVAGQVADVAGDIVRDNKVPVMLGGEHTATVGTVRAVRP
DVYVVCDAHLDLRDELDGTPYSHGCVTRRVLDTVEDVVIIGARSGDREQYEIAAERTRLY
TADTVREQGIDAVLREVREHVAGRRIYLSIDADAIDCCLTPGLGTPEPFGMTPLDIREVV
RALAPEVAGFDYVEVAPFDTGQTAAVAAQIVREFIARHWLAGQ
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaactcgcccatctccattttgcggatgcggatgcgtcatacgaggatgcccgc
tacgccgtcttcggcgtgccctacgacggtacgacgtcgtttcggccggggacgcggttc
gggccccgggcgatccgggaggtctcgttcaatttcgagtcctacgatcccgcgaccaaa
atagacttttctgaagtgccgatcacggatctcggcgaccttgcggtctcccggctgccc
gaggaggtcgccgggcaggtggcggacgtcgcgggggatatcgtccgcgacaacaaggtg
ccggtgatgctcggcggcgagcacaccgcgactgtcggcacggtccgggccgtccggccg
gatgtctacgtcgtctgcgacgcccacctggatctccgggacgaactcgacgggacgcct
tacagtcatgggtgcgtcacccggcgcgtcctcgatacggtcgaagacgtcgtcatcata
ggtgcccggagcggcgatcgcgagcagtatgagattgcggcggagaggacgcgcctctac
accgccgatacggtgcgggaacaggggatcgacgccgtcctccgggaggtccgggagcac
gttgcggggaggaggatctacctctcgatcgacgcagatgcgatcgactgctgtctcacc
cccggcctcgggacgcccgaaccgttcgggatgacgccgctcgatatccgggaggtcgtg
cgtgccctcgcgcccgaggtcgcgggtttcgattacgttgaggtcgcgccgttcgatacc
gggcagacggcggcggtggcggcgcagatcgtgcgggagttcatcgcccggcactggctc
gccgggcagtga

DBGET integrated database retrieval system