KEGG   Methanoculleus marisnigri: Memar_0981Help
Entry
Memar_0981        CDS       T00477                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mem  Methanoculleus marisnigri
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mem00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
964290..965273
Genome map
AA seq 327 aa AA seqDB search
MFPERRMRRMRRRIIQPLLRETELRKTDLIAPVFVDESISAPLPVASMPGQFRHPTDDVA
DYCERLRAAGIRAVLLFGVPAAKDGEATEAYAADGVVQRAVRNIKERLPEIVVITDVCAC
EYTDHGHCGIVGETADGPDLLNDPSLELMAQIAVSHARSGADIVAPSCMLDGMVRAIRQA
LDAAGYQDVLIMSYSSKFASALYGPFRDAADSGFSFGDRTTYQICPGNAREAVMESELDM
AEGADILMVKPAGAYLDILAAVTGFGLPVAAYQVSGEYAMIKAAAERGWLDERAVAIETL
TAIKRAGADLIITYFAEDAARWLDEEQ
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtttccagaacgaagaatgagacggatgcggcggcggattatccagccgctcctccgc
gaaaccgaactgcgaaagaccgacctcattgcgccggtcttcgtggacgaatcgatcagt
gcaccgcttccggtcgcctcgatgccggggcagttccgccacccgacggacgacgtcgcc
gactattgcgagcgcctccgggctgccggcatccgggcggtgctcctcttcggggttccg
gccgcaaaggacggcgaggcgaccgaagcctacgcggcggacggcgtcgtccagcgtgcc
gtccgcaatatcaaggagcggttgccggagatcgtcgtcatcaccgacgtctgcgcctgc
gagtacaccgaccacggccactgtggcatcgtgggagagaccgccgacggccccgacctc
ctaaacgacccctcgctcgaactgatggcgcaaatagccgtctcccacgcacggagcggc
gccgatatcgtcgcgccgtcgtgcatgctcgacgggatggttcgcgcgatccggcaggct
ctcgacgccgccggataccaggacgtcctgatcatgtcctactcctcgaagttcgcgagc
gctctctacgggccgttccgcgacgcggcggactcggggttcagtttcggcgaccggacg
acctaccagatctgcccgggcaacgcacgggaggcggtgatggagtcggagctcgacatg
gccgaaggggcggatatcctgatggtcaagcccgcgggggcctacctcgacatcctcgcg
gccgtcacggggttcggactgccggtcgcggcctaccaggtcagcggtgagtacgcgatg
atcaaggccgccgcagaacgcgggtggctggacgagcgggcggtcgccatcgagaccctc
accgccatcaagcgtgccggggccgacctgatcatcacctactttgcagaagacgcggcg
aggtggctcgatgaagagcagtga

DBGET integrated database retrieval system