KEGG   Methanoculleus marisnigri: Memar_0981Help
Entry
Memar_0981        CDS       T00477                                 

Definition
(GenBank) porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
mem  Methanoculleus marisnigri
Pathway
mem00860  Porphyrin and chlorophyll metabolism
mem01100  Metabolic pathways
mem01110  Biosynthesis of secondary metabolites
mem01120  Microbial metabolism in diverse environments
Module
mem_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mem00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Memar_0981
Enzymes [BR:mem01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Memar_0981
Exosome [BR:mem04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Memar_0981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD Ubiq_cyt_C_chap
Motif
Other DBs
NCBI-ProteinID: ABN56914
UniProt: A3CU64
Position
964290..965273
Genome map
AA seq 327 aa AA seqDB search
MFPERRMRRMRRRIIQPLLRETELRKTDLIAPVFVDESISAPLPVASMPGQFRHPTDDVA
DYCERLRAAGIRAVLLFGVPAAKDGEATEAYAADGVVQRAVRNIKERLPEIVVITDVCAC
EYTDHGHCGIVGETADGPDLLNDPSLELMAQIAVSHARSGADIVAPSCMLDGMVRAIRQA
LDAAGYQDVLIMSYSSKFASALYGPFRDAADSGFSFGDRTTYQICPGNAREAVMESELDM
AEGADILMVKPAGAYLDILAAVTGFGLPVAAYQVSGEYAMIKAAAERGWLDERAVAIETL
TAIKRAGADLIITYFAEDAARWLDEEQ
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtttccagaacgaagaatgagacggatgcggcggcggattatccagccgctcctccgc
gaaaccgaactgcgaaagaccgacctcattgcgccggtcttcgtggacgaatcgatcagt
gcaccgcttccggtcgcctcgatgccggggcagttccgccacccgacggacgacgtcgcc
gactattgcgagcgcctccgggctgccggcatccgggcggtgctcctcttcggggttccg
gccgcaaaggacggcgaggcgaccgaagcctacgcggcggacggcgtcgtccagcgtgcc
gtccgcaatatcaaggagcggttgccggagatcgtcgtcatcaccgacgtctgcgcctgc
gagtacaccgaccacggccactgtggcatcgtgggagagaccgccgacggccccgacctc
ctaaacgacccctcgctcgaactgatggcgcaaatagccgtctcccacgcacggagcggc
gccgatatcgtcgcgccgtcgtgcatgctcgacgggatggttcgcgcgatccggcaggct
ctcgacgccgccggataccaggacgtcctgatcatgtcctactcctcgaagttcgcgagc
gctctctacgggccgttccgcgacgcggcggactcggggttcagtttcggcgaccggacg
acctaccagatctgcccgggcaacgcacgggaggcggtgatggagtcggagctcgacatg
gccgaaggggcggatatcctgatggtcaagcccgcgggggcctacctcgacatcctcgcg
gccgtcacggggttcggactgccggtcgcggcctaccaggtcagcggtgagtacgcgatg
atcaaggccgccgcagaacgcgggtggctggacgagcgggcggtcgccatcgagaccctc
accgccatcaagcgtgccggggccgacctgatcatcacctactttgcagaagacgcggcg
aggtggctcgatgaagagcagtga

DBGET integrated database retrieval system