KEGG   Methanoculleus marisnigri: Memar_1052Help
Entry
Memar_1052        CDS       T00477                                 

Definition
(GenBank) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mem  Methanoculleus marisnigri
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mem00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Memar_1052
   01230 Biosynthesis of amino acids
    Memar_1052
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Memar_1052
  Energy metabolism
   00680 Methane metabolism
    Memar_1052
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Memar_1052
Enzymes [BR:mem01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Memar_1052
Exosome [BR:mem04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Memar_1052
  Exosomal proteins of melanoma cells
   Memar_1052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1039284..1040024
Genome map
AA seq 246 aa AA seqDB search
MLILLRHGESTWNRENRFTGWTDVDLSPQGVKEAHKAAELLRDGGYTFGVAYTSVLKRAI
RTLWIVMDDLDLMYVPVHRSWRLNEKGYGVLQGLNKQETAEKYGAKQVHLWRRAYDVRPP
PLAWDDPRHPRFDPRYADLDQETLPATESLHDTLERVLPYWESHITEDLRRGKPVLVSAH
GNSLRALVKHLDNVPDDEIAGLNIPTGYPLVYELDEDLKAVKHYYLGDPEEIAAAARGVA
RQAGPG
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttgatccttctgcgacacggcgagagcacctggaacagggagaaccggttcacgggc
tggaccgacgtggacctctctccgcagggtgtaaaagaagctcataaggcggcggaactc
ctcagggacggcgggtacacgttcggcgtcgcctatacctccgtcctgaagcgggcgatc
cggacgctctggatcgtgatggacgacctcgatctcatgtacgttcccgtgcaccggtcg
tggcggctgaacgagaagggttacggcgtcctgcagggtttgaacaagcaggagaccgcg
gagaagtacggtgcgaagcaggtgcatctctggcgccgggcatacgacgtgcggccgccg
ccgctcgcgtgggacgatccgaggcacccgcggttcgacccccgctacgcggatctcgac
caggagaccctccctgcgaccgagtccctgcacgacacgctcgagcgggtgctcccctac
tgggagagccatatcaccgaagatctccggcggggcaaacccgtcctggtctccgcccac
gggaacagtctccgggctctggtcaagcacctggacaatgttcccgacgacgagatcgcg
gggctcaacattcctaccggctacccgctcgtctacgaactggacgaggacctgaaggcc
gtgaagcactactacctcggcgacccggaggagatcgcggcggccgcccggggcgtcgcc
cggcaggcagggccgggataa

DBGET integrated database retrieval system