KEGG   Methanoculleus marisnigri: Memar_1052Help
Entry
Memar_1052        CDS       T00477                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mem  Methanoculleus marisnigri
Pathway
mem00010  Glycolysis / Gluconeogenesis
mem00260  Glycine, serine and threonine metabolism
mem00680  Methane metabolism
mem01100  Metabolic pathways
mem01110  Biosynthesis of secondary metabolites
mem01120  Microbial metabolism in diverse environments
mem01130  Biosynthesis of antibiotics
mem01200  Carbon metabolism
mem01230  Biosynthesis of amino acids
Module
mem_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mem_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mem00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Memar_1052
  Energy metabolism
   00680 Methane metabolism
    Memar_1052
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Memar_1052
Enzymes [BR:mem01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Memar_1052
Membrane trafficking [BR:mem04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Memar_1052
Exosome [BR:mem04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Memar_1052
  Exosomal proteins of melanoma cells
   Memar_1052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABN56985
UniProt: A3CUD5
Position
1039284..1040024
Genome map
AA seq 246 aa AA seqDB search
MLILLRHGESTWNRENRFTGWTDVDLSPQGVKEAHKAAELLRDGGYTFGVAYTSVLKRAI
RTLWIVMDDLDLMYVPVHRSWRLNEKGYGVLQGLNKQETAEKYGAKQVHLWRRAYDVRPP
PLAWDDPRHPRFDPRYADLDQETLPATESLHDTLERVLPYWESHITEDLRRGKPVLVSAH
GNSLRALVKHLDNVPDDEIAGLNIPTGYPLVYELDEDLKAVKHYYLGDPEEIAAAARGVA
RQAGPG
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttgatccttctgcgacacggcgagagcacctggaacagggagaaccggttcacgggc
tggaccgacgtggacctctctccgcagggtgtaaaagaagctcataaggcggcggaactc
ctcagggacggcgggtacacgttcggcgtcgcctatacctccgtcctgaagcgggcgatc
cggacgctctggatcgtgatggacgacctcgatctcatgtacgttcccgtgcaccggtcg
tggcggctgaacgagaagggttacggcgtcctgcagggtttgaacaagcaggagaccgcg
gagaagtacggtgcgaagcaggtgcatctctggcgccgggcatacgacgtgcggccgccg
ccgctcgcgtgggacgatccgaggcacccgcggttcgacccccgctacgcggatctcgac
caggagaccctccctgcgaccgagtccctgcacgacacgctcgagcgggtgctcccctac
tgggagagccatatcaccgaagatctccggcggggcaaacccgtcctggtctccgcccac
gggaacagtctccgggctctggtcaagcacctggacaatgttcccgacgacgagatcgcg
gggctcaacattcctaccggctacccgctcgtctacgaactggacgaggacctgaaggcc
gtgaagcactactacctcggcgacccggaggagatcgcggcggccgcccggggcgtcgcc
cggcaggcagggccgggataa

DBGET integrated database retrieval system