KEGG   Methanoculleus marisnigri: Memar_1054Help
Entry
Memar_1054        CDS       T00477                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mem  Methanoculleus marisnigri
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mem00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Memar_1054
Enzymes [BR:mem01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Memar_1054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1040724..1042223)
Genome map
AA seq 499 aa AA seqDB search
MIQTRGSGILLHITSLPSPYGVGDFGPAAYRFVDALERGRQHYWQILPLNPTETAYAHSP
YSSPSAFAANILLISPEMLVREGYLRKSELEPAPGFPEERAAYEAAAWYRERLFAAAYER
FRHSGPDRRFETFCDGTGWWLDDHALFVALKGHFRGQAWNRWPEDIRARETGALKEMREL
LDDRIRKEKFLQYIAARQWSALRRYCTERGIQVIGDIPIYVAYDSVDVWAHPGIFKLDED
LRPTVVAGVPPDIFSRTGQLWGNPVYDWAALRERGYDWWAGRIARSAELYDLFRIDHFRA
FADYYEVPAGDATAERGTWVDGPGEDFFEALARKHPCFPIVAEDLGANTPAVQALLDRFD
FPGMKILLFAFGEGIARTPHIPHNYVHNLICYTGTHDNNTARGWFEEEASEEDKERFFTY
IGREVAADEVHRELVRLAMTSVARACIVPMQDVLGLGAAARMNYPSTTTGNWVWRMTPEE
FAGAPFEWLRGLTELTGRG
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgattcagacacgggggagcggcatactcctgcatatcacgtccctgccgtcaccgtac
ggcgtcggcgatttcggtccggcggcataccggttcgtcgatgcgcttgagcggggccgg
cagcactactggcagatcctgccgctcaacccgacagagacggcatacgcccactccccc
tactcgagcccgtcggcgttcgccgcaaacatcctcctcatcagccccgagatgctcgtc
cgggaaggctatctcaggaagagcgaactggagccggcgcccgggttcccggaggagcgg
gcggcgtacgaggcggccgcatggtaccgggaacggctgttcgcggctgcctacgagcgg
ttccgccactccgggccggatcgcaggttcgagacgttctgcgacggcacgggatggtgg
ctcgacgaccacgcgctcttcgtcgcgttaaaaggccatttccgcgggcaggcgtggaac
cggtggccggaggatatccgggcaagggaaacgggagccctcaaagagatgcgcgaactg
ctcgacgaccggatacgaaaagagaagttcctccagtacatcgccgcccgccagtggtcg
gccctccggcgctactgcaccgaacggggcatccaggtcatcggcgacatcccgatctac
gtcgcgtatgacagcgtcgacgtctgggcgcaccccgggatcttcaaactggacgaagac
ctccgcccgaccgtggtggcgggggtgccgccagatatcttcagcaggaccgggcagctc
tgggggaacccggtctacgactgggccgcactccgggagcgcggttacgactggtgggcg
ggccggatcgcccggtccgccgaactctacgacctcttccggatcgaccacttccgggca
ttcgccgactactacgaggttccggcgggcgacgcgacggccgagcgcggcacctgggtc
gacgggccgggagaagacttcttcgaggcgctcgcccgaaagcacccctgctttcctatc
gtcgccgaagacctgggggcgaacacccccgccgtccaggccctcctcgaccggttcgac
ttcccggggatgaagatcctcctcttcgcgttcggcgaggggatcgcaagaaccccccat
atcccgcacaactacgtccataacctcatctgctacacggggacgcacgacaacaacacc
gcacggggatggttcgaggaggaggcgtcggaggaggataaggagaggttcttcacctat
atcgggcgggaggtggcggcggacgaggttcaccgggagctcgtccggctggcgatgacc
tcggtcgcccgggcgtgcatcgtcccgatgcaggacgtcctcggcctcggtgccgcggca
cggatgaactacccctcgaccaccacggggaactgggtgtggcggatgacgccggaggag
ttcgccggtgcgccgttcgagtggctcagggggcttacggaactcaccggacgggggtga

DBGET integrated database retrieval system