KEGG   Methanoculleus marisnigri: Memar_1089Help
Entry
Memar_1089        CDS       T00477                                 

Definition
quinolinate phosphoribosyl transferase
Orthology
K00763  
nicotinate phosphoribosyltransferase [EC:6.3.4.21]
Organism
mem  Methanoculleus marisnigri
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:mem00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1078834..1079958
Genome map
AA seq 374 aa AA seqDB search
MGWFEVVGEDAIKNGTCTDIYFRRVVEVMERDGINPHVTMEVTASMLPDPWGVFCGLDDV
IKLLEGLPVDVDAMPEGSIFFKNEPVLRVSGRYRDFAVYETAILGFLCHASGVASAAAHM
KLAAGGRPVFSFGSRRQHPAIAAMIERAAWIGGVDGASNTCAPDGIPLAGTMPHAFIMCY
PEQEDAWLAFAQGAGPEVPRIMLADTFSDETDEAVRAAASGATAVRLDTPRSRRGDMRAI
VEEVRWELDVNGYPDVKIFLSGGLSRAEVAAYRDIGDAFGVGGAIANAPVIDFALDIVEM
KGRPYAKRGKRSSAKQVYDLGGRRLTLPARTPAPKGAVPLLAPCIKNGTALVRPKMEDAR
ERVLSRLPALAGEG
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgggctggtttgaggtggtcggcgaggacgccatcaagaacggaacgtgcacggatatc
tacttccggcgggtcgtggaggtcatggagcgggacggcatcaacccgcacgtcacgatg
gaggtgacggcgtcgatgctccccgacccatggggggtcttctgcgggcttgacgacgtc
ataaaactgctcgaaggccttccggtggacgtggacgcgatgccggagggctcgatcttc
ttcaaaaacgagccggtcctccgggtctccgggcgctaccgggacttcgcggtctacgag
acggccatcctcgggttcctctgccacgcttcaggcgtggcctcggcggccgcccacatg
aaactggccgcggggggccggccggtcttctccttcggctcgcgccgccagcacccggcg
atcgcggcgatgatcgagcgggcggcctggatcggcggggtggacggggcgagcaacacc
tgtgcgccggacgggatcccgctcgcggggacgatgccgcacgcgttcatcatgtgctac
ccggagcaggaggacgcctggctcgcgttcgcccagggtgccggcccggaggtgccgcgg
atcatgctcgcggacaccttctccgacgagacggacgaggcggtccgggcggcggcttcg
ggggcgacggcggtgcggctcgacaccccgcggtcgcgccggggggacatgcgggcgatc
gtcgaggaggtgcgctgggagctcgacgtcaacggctacccggacgtgaagatcttcctc
tcgggcgggctgtcgcgcgcagaggtcgccgcctaccgcgatatcggcgacgccttcggc
gtcgggggcgcgatcgcgaacgccccggtgatcgacttcgcgttggacatcgtggagatg
aagggccggccctacgcgaagcgcgggaagcggagcagcgcaaagcaggtctacgatctc
ggcggccggcgcctcaccctccccgcccgcaccccggcgccgaagggcgcggtgccgctc
ctcgccccctgcatcaagaacggcaccgccctcgtccgcccgaagatggaggatgcgcgg
gaacgggtgctctcccgcctcccggcccttgccggggagggatag

DBGET integrated database retrieval system