KEGG   Methanoculleus marisnigri: Memar_1151Help
Entry
Memar_1151        CDS       T00477                                 

Definition
AMP-dependent synthetase/ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mem  Methanoculleus marisnigri
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mem00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Memar_1151
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Memar_1151
   00620 Pyruvate metabolism
    Memar_1151
   00640 Propanoate metabolism
    Memar_1151
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Memar_1151
   00680 Methane metabolism
    Memar_1151
Enzymes [BR:mem01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Memar_1151
Lipid biosynthesis proteins [BR:mem01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Memar_1151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1134282..1135982
Genome map
AA seq 566 aa AA seqDB search
MQTAVPAGIQPANAREPNMTDYEAACANFTIDVPDQFNFGYDVIDRWAETDRNKLAMIWV
NQEGEERKYTFRDLRYLSNGAANILLKYGIKKGDRVMLMLPRIPEWWIFVIALIKLGAVF
CPCPTMLTPKDIKYRVQAGKFRMIITNLENAEKVDEVADACPLLDTLFLADGEREGWASY
PHEIEYPAPVSHHKVSMPVAKKTKSIDPMMIYFTSGTTGEAKMVLHNQSYPLGHIITASL
WQDVTENDLHLTFSDTGWAKCAWGKIFGQWIAGACIFVYDIRGKFGATELLPLIERYEVT
TFCAPPTVYRMLILADLDKFDFRDLRHCCSAGEPLNPEVIRVWEDGTGQAIYEGYGQTET
VCCIATFPCMQHKPGSMGKPAPGWHIELHDDDGNPAGPGEEGRIAVKLDPRPVGLFVEYL
DNPEANRESFQNGYYYTGDKARMDEDGYFWFIGRSDDVIKSSGYRIGPFEVESALMEHPA
VQESAVVGSPDLIRGMVVKAFIVLKPGYQPSESLVKELQAHVRNTTAPYKYPRAIEFVQE
LPKTISGKIQRNVLRDQELRMSNNGN
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaccgcggttcccgcggggatacagcctgcaaacgcccgggagccgaatatgacc
gattacgaggccgcctgcgccaacttcacgatcgacgtccccgaccagttcaacttcggc
tacgacgtgatcgaccggtgggccgagaccgaccggaacaagctcgccatgatctgggtg
aaccaggaaggggaagaacggaagtacacgttccgcgatctgcggtacctctccaacggt
gccgcgaacatcctcctcaagtacggcatcaagaagggcgaccgggtcatgctgatgctc
ccgcggatcccggaatggtggatcttcgtcatcgctctcatcaaactcggcgcggtcttc
tgcccctgcccgacgatgctgacgccgaaggacatcaaatatcgcgtgcaggccgggaag
ttccggatgatcatcacgaacttggagaatgccgagaaggtcgacgaggtcgccgatgcc
tgcccgctgctcgacaccctcttcctcgcggacggggagcgggagggctgggcgagttac
ccgcacgagattgagtaccctgcaccggtatcgcaccacaaggtcagcatgccggtcgcg
aagaagacgaaatcgatcgacccgatgatgatctacttcacctcgggcaccaccggcgag
gccaagatggtgctgcacaaccagagttacccgctcgggcacatcatcaccgcctcgctc
tggcaggacgtcacggagaacgacctgcacctgacgttctccgataccggctgggcgaag
tgcgcctggggcaagatattcggccagtggatcgccggagcctgcatcttcgtctacgat
atccgggggaagttcggcgcgaccgagctcctcccgctgatcgagaggtacgaggtgacc
acgttctgcgcaccgccgacggtctaccggatgctgatcctcgccgatctcgacaagttc
gacttccgcgacctgcggcactgctgcagcgccggggaaccgctcaaccccgaggtgatc
cgcgtctgggaggacggcaccgggcaggccatctacgagggatacggccagacggagacc
gtctgctgcatcgccacgttcccctgcatgcagcataagcccgggtccatggggaaaccc
gcaccgggctggcatatcgagctccacgacgacgacggcaacccggccggccccggcgag
gaagggcggatcgcggtcaaactcgacccccggccggtcgggctcttcgttgagtacctg
gacaaccccgaggcgaaccgggaatcgttccagaacgggtactactacaccggcgacaag
gcgcgtatggacgaggacggctacttctggttcatcggaaggagcgacgacgtcatcaag
tcgtccggctaccggatcgggccgttcgaggtcgagagcgccctcatggagcacccggcc
gtccaggaatcggcggtcgtcgggtcgcccgacctcatccgggggatggtcgtcaaggcc
ttcatcgtgttgaagcccggctaccagccgtccgaatcgctggtcaaggaacttcaggcc
cacgtccggaacaccaccgccccgtacaagtacccgcgggcgatcgagttcgtccaggaa
ctcccgaagacgatatccggcaagatccagaggaacgtcctgcgggaccaggaactgcgg
atgagtaataacgggaactga

DBGET integrated database retrieval system