KEGG   Methanoculleus marisnigri: Memar_1263Help
Entry
Memar_1263        CDS       T00477                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mem  Methanoculleus marisnigri
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mem00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1240841..1242337)
Genome map
AA seq 498 aa AA seqDB search
MNRRSSGVLLHVTSLPSPYGIGDLGPAAYRFVDLLSRAGQRYWQILPLNPTCPEFANSPY
QSTSAFAGNTWLISPEQMVADGFLAPEDIADPPDFPADRVDYRAVLDYKNGLFDTAFERF
KGRDSDFRYEDFAADNTSWLNDYAIFMALRERFSGKVWGDWPAGIRDRHDEALRKYGTEL
ADRIFREKFLQYVFDRQWETLKKHCRMRHLQIVGDIPFYLTYDSVDLWANPRLFKLDEQK
KPTAVAGVPPDMFSDAGQLWGNPVYNWDAHRERGFGWWESRIDRTLALVDRLRLDHFRGF
VQFWEVPAGEETARNGHWVDAPGRDLFTLLARSRSCLPIIAEDLGHITPDVHEMMAYFGF
PGMKILTFGFSGDVAQNPHAPHNITEGSVAYTGTHDNNTVRGWFGREVPDDQKNLLFRYI
GGPVSGDEIHRILIRLAMLSPADTVIVPMQDILGLGEEARMNRPGTTEGNWEWRLRPDQA
GEESMREFAEVTGIYGRG
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggcggagcagcggggttctcctgcacgtcacgtcgctgccgtcgccgtacggg
atcggcgatctcggacccgcggcgtaccggttcgtggatctcctcagccgtgccgggcag
cgctactggcagatcctccccctcaacccgacgtgcccggagttcgccaactcgccttac
cagagcacctcagcgttcgccggaaacacctggctcatcagccccgagcagatggtcgcg
gacggtttcctcgccccggaggatatcgcagacccgccggactttcctgcggaccgggtc
gactaccgggcggttctcgactacaagaacggtctcttcgatacggcgttcgaacggttc
aagggacgcgattcggattttcgctacgaagatttcgcggccgacaacacgtcgtggctc
aacgactatgccatcttcatggcactcagggagcggttctccggaaaggtctggggcgac
tggccggccggaatccgggaccggcacgatgaggcgttgcggaagtacggcacggaactt
gccgaccggatctttcgggagaagttcctccagtacgtcttcgaccgtcagtgggagacg
ctcaagaagcattgccgcatgcgccacctccagatcgtcggggacatcccgttctacctc
acctacgacagcgtcgacctctgggcaaacccgcggctcttcaaactcgacgagcagaag
aagccgactgccgtcgcgggcgtgccgccggatatgttcagcgatgccgggcagctctgg
gggaacccggtctacaactgggacgcgcaccgggagcggggattcgggtggtgggagagc
cggatcgatcgcaccctcgccctcgtcgaccggctgcgcctcgaccacttccgggggttc
gtgcagttctgggaggtgccggccggggaagagaccgcacggaacgggcactgggtcgac
gcgcccggcagagacctcttcacgctgcttgcacggagcaggtcgtgccttcccatcatc
gccgaagacctcggtcacatcactcccgacgtccacgagatgatggcgtatttcgggttc
ccggggatgaagatcctgaccttcggcttctccggcgacgtcgcgcagaacccccatgcg
ccccacaacatcacggaaggttccgtcgcctacacggggacgcacgacaacaacaccgtc
cgggggtggttcgggcgcgaggtccccgacgaccagaagaacctcctgttccgctacatc
gggggaccggtgagcggcgatgagatacaccggatcctcatccgtctcgcgatgctctcc
cccgccgataccgtcatcgtcccgatgcaggacatcctcggtctcggggaggaggcgcgg
atgaaccgcccgggcacgacggaggggaactgggagtggcggctccggcccgaccaggca
ggggaagagagcatgcgggagttcgccgaggtgacggggatttatgggagggggtga

DBGET integrated database retrieval system