KEGG   Methanoculleus marisnigri: Memar_1265Help
Entry
Memar_1265        CDS       T00477                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mem  Methanoculleus marisnigri
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mem00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Memar_1265
Enzymes [BR:mem01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Memar_1265
Exosome [BR:mem04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Memar_1265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1244733..1246661)
Genome map
AA seq 642 aa AA seqDB search
MQQALPDITKTGTLVTDYDVYLFRQGNHTRLYEKLGAHPAVADGVQGTFFSVWAPNAAEV
SVIGDFNGWKAGEHPLTARGDNSGIWEGFVPELGQGALYKYHIRSRYRDYCVEKGDPFAR
FWEVPPKTASVVWDTAYAWRDRSWMRCREEANTPDAPVSVYEVHIGSWRMPEGERRCTSY
RELATELADYLLEAGFTHVEFLPVMEHPLYASWGYQTLGYFAPTSRYGTPQDFMHLVEHL
HLRGIGVILDWVPSHFPSDGYGLSYFDGTYLYEHALPGRRYHPEWKSYVFNLARNEVRSF
LISSAVFWLERYHADGLRVDAVSSMLYLDYARSAGEWTPNVYGGRENLEAMVFLRKVNDT
VHANFPDVLVIAEEATAWPGVTAPTATGGLGFDLKWNMGWMHDALDYFTLDPVFRKYRPD
LLTFSIWYAFSERYVLPLSHDEVVHEKSSLIGKMPGDEWRKRANLRLLYGYMFTHPGKKL
LFMGGEFGQWPEWSHETGLEWDLLQYAPHQGILRWVTDLNRLYRRKPALHERDADQAGFE
WVDFSDVEKSVVSYLRRGRSADDVVLVICNFTPVPRYDYRIGVPFGGFWKEVLNSDAVEY
GGSGVGNLGGVEAERIPAHGRSCSLPLTLPPLGVVVFCPEGA
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcaggcgttgcccgacatcacgaagaccgggactctcgtcaccgactacgatgtc
tacctcttccggcagggtaaccacacccgcctctacgagaagctgggagcgcatcccgcc
gtcgccgacggtgtgcaggggacgttcttttccgtctgggcgccgaacgccgcggaagtc
tcggtcatcggggacttcaacggatggaaggcgggcgaacacccgctcacggcgcggggc
gacaactccggcatctgggaggggttcgtcccggaactcggccagggggcgctctacaaa
taccacatcaggagcaggtaccgcgactactgcgtggagaagggcgacccgttcgcccgc
ttctgggaggttccgccgaagaccgcgtccgttgtctgggacactgcctacgcctggcgc
gaccggtcgtggatgcgctgccgggaagaggcgaacaccccggacgccccggtatccgtc
tatgaggttcatatcggttcgtggcggatgccggagggggagagacggtgcacgagctac
cgggagcttgcaaccgaactcgccgactacctgctcgaggcggggttcacgcacgtcgag
tttctcccggtcatggagcatccgctctacgcctcctggggctaccagacgctcggctac
tttgcccccacgagcaggtacggcaccccgcaggacttcatgcacctcgtcgagcacctc
cacctgcgcgggatcggggtaatcctcgactgggtgccgtcccacttcccgtccgacggc
tacggcctctcctacttcgacggcacctacctctacgagcatgccctccccggccggcgc
taccacccggaatggaagagttacgtcttcaatctcgcgaggaacgaggtcaggtcgttt
ctcatcagcagcgccgtcttctggctcgaacgctaccacgcggacggtctccgggtcgac
gcggtctcttcgatgctctacctcgattacgcccggagcgccggagaatggacgccgaac
gtctacggcgggcgggagaacctcgaggcgatggtgtttctccggaaggtgaacgacact
gtccacgccaacttcccggacgtcctcgtcatcgccgaggaggcgaccgcctggccgggg
gtgaccgccccgaccgcgaccggggggctcgggttcgacctgaagtggaacatgggctgg
atgcacgatgcgctggactacttcacgctcgacccggtctttcggaagtaccgccccgat
ctcctgacgttcagcatatggtacgcgttctccgagcgttatgtcctccccctctcgcac
gacgaggtcgttcacgagaaaagttcgctcatcgggaagatgcccggcgacgagtggcgg
aaacgggcgaatcttcgtctcctatatgggtatatgttcacgcacccgggcaagaaactc
ctcttcatggggggcgagttcgggcagtggccggagtggagccacgagaccgggctcgag
tgggacctcctgcagtacgccccgcaccaggggatcctccggtgggttaccgatttgaac
cgcctctaccggcggaagcctgccctccacgagcgggacgccgatcaggcggggttcgag
tgggtcgatttctcggacgtcgagaagagcgtcgtcagctacctgcggcgggggcggtcg
gccgacgacgtcgtcctggtcatctgcaacttcaccccggtgccgcgctacgactaccgg
atcggcgtcccgttcggcgggttctggaaagaggtgctcaacagcgatgcggtcgagtac
ggcgggagcggtgtcgggaacctcggcggggtggaagcggagcgaatcccggcccacggc
cggtcgtgttcgcttccgctcaccctgcccccgctcggggtggtcgtcttctgtcccgag
ggggcgtga

DBGET integrated database retrieval system