KEGG   Methanoculleus marisnigri: Memar_1292Help
Entry
Memar_1292        CDS       T00477                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mem  Methanoculleus marisnigri
Pathway
mem00010  Glycolysis / Gluconeogenesis
mem00051  Fructose and mannose metabolism
mem00562  Inositol phosphate metabolism
mem01100  Metabolic pathways
mem01110  Biosynthesis of secondary metabolites
mem01120  Microbial metabolism in diverse environments
mem01130  Biosynthesis of antibiotics
mem01200  Carbon metabolism
mem01230  Biosynthesis of amino acids
Module
mem_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mem_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mem00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Memar_1292
   00051 Fructose and mannose metabolism
    Memar_1292
   00562 Inositol phosphate metabolism
    Memar_1292
Enzymes [BR:mem01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Memar_1292
Exosome [BR:mem04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Memar_1292
  Exosomal proteins of bladder cancer cells
   Memar_1292
  Exosomal proteins of melanoma cells
   Memar_1292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG IGPS
Motif
Other DBs
NCBI-ProteinID: ABN57222
UniProt: A3CV22
Position
complement(1272889..1273557)
Genome map
AA seq 222 aa AA seqDB search
MDSPFVLVNLKTYQEGMGSNAHRIAAAAETVAKESGAVIGIAPAFTELHPMSHHYAIPVY
AQHIDAITPGAHTGHILPEAVRSAGARGTLINHSERRLTLADIGACVESARRLHLETVVC
TNNDATSAAAAALRPDYVAIEPPELIGSGVSVSKADPGIIERSVNAVRAVNPDVNVLTGA
GIQSGECVKIAVDLGTCGVLLASSVVKADDPEAVLRDLVSLL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggattccccgttcgttctggtcaatctcaagacctatcaggaaggcatgggcagcaac
gctcaccggatcgccgctgcggccgagaccgtggcaaaagagagcggagccgtcatcggc
atcgcgccggccttcaccgagcttcacccgatgagccaccactacgcgatcccggtctac
gcccagcatatcgacgcgatcaccccaggcgcccataccgggcatattctcccggaagcc
gtccggtcggcgggcgcacgcggcaccctgatcaaccactccgagcgccgcctcaccctg
gccgatatcggcgcctgcgtcgagagcgcccggaggctccacctcgagacggtcgtctgc
acgaacaacgacgcgacgagcgccgccgccgcagcgctccggcccgactacgtggcgatt
gagcccccggagctgatcgggagcggggtctcggtctcgaaggccgacccggggatcatc
gagcggtcggtcaacgccgtccgggcggtgaacccggacgtgaacgtcctgaccggggcg
ggcatccagtcgggcgagtgcgtgaagatcgccgtcgacctcgggacatgcggtgttctc
ctcgcctcaagcgtggtcaaggccgacgatcccgaagcggtcctccgggacctggtctcg
ctgctctaa

DBGET integrated database retrieval system