KEGG   Methanoculleus marisnigri: Memar_1367Help
Entry
Memar_1367        CDS       T00477                                 

Definition
aldolase (EC:4.1.2.13)
Orthology
K16305  
fructose-bisphosphate aldolase / 6-deoxy-5-ketofructose 1-phosphate synthase [EC:4.1.2.13 2.2.1.11]
Organism
mem  Methanoculleus marisnigri
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mem00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Memar_1367
   01230 Biosynthesis of amino acids
    Memar_1367
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Memar_1367
   00030 Pentose phosphate pathway
    Memar_1367
   00051 Fructose and mannose metabolism
    Memar_1367
  Energy metabolism
   00680 Methane metabolism
    Memar_1367
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Memar_1367
Enzymes [BR:mem01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.11  6-deoxy-5-ketofructose 1-phosphate synthase
     Memar_1367
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Memar_1367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1358876..1359799
Genome map
AA seq 307 aa AA seqDB search
MPPAPDIRIPLDVPSEEQERYRENYSAITHGTGRLMLFAGDQKVEHLNDDFFGEGIHPED
ADPEHLFRIASRARIGVFATQLGMIARYGGDYRDVPYLVKLNSKTNLVGTSQRDPLSSEL
HLVRQVVDLRDRTGLSILGVGYTVYLGSEYEAMMLYQAAQIVNNAHQNGLITVLWMYPRG
KAVKDERDPHLIAGAAGVAATLGTDFAKVNPPKVGKSVDAALLREAVAAAGRTGVVCAGG
SHADMQEFLQQLHDQIHIGGTVGNATGRNIHQRSLDEAVRFCNAISAITLDDASVEEANE
ICTGGRC
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgccacctgcacccgatatcaggatccctctcgatgtgccttccgaggagcaggagagg
taccgggagaattacagtgcgatcacgcacggcaccgggaggctgatgctctttgccggt
gaccagaaggtcgagcacctcaacgacgatttcttcggcgaaggcatccaccccgaggat
gccgatcccgaacacctcttccggattgcgagccgggcgaggatcggggtctttgcgacg
cagctcgggatgatcgcccggtacggcggggactaccgtgacgtgccgtacctcgtcaag
ctcaactccaagaccaatctggtcgggacctcccagcgcgacccgctcagctcggaactc
catcttgtccggcaggtcgtcgacctccgggaccggacggggctctcgatcctcggcgtc
ggctacacggtctacctggggagcgaatacgaggcgatgatgctctaccaggctgcgcag
atcgtcaacaacgcgcaccagaacggccttatcaccgtgctctggatgtatcctcgcggc
aaggcggtcaaggacgagcgggacccgcacctgatcgcgggcgcggcgggtgtcgcggcg
accctcgggaccgacttcgcgaaggtgaacccgcccaaagttggtaaatcggtcgacgct
gcgctgctcagggaggcggtggcggccgcaggcaggaccggtgtcgtctgtgccggcggg
tcgcatgccgatatgcaagagttcctgcagcagctccacgaccagattcatatcggcggc
acggtcgggaacgcgaccggcaggaacattcaccagcggtcgcttgatgaggctgtccgg
ttctgcaacgcgatatcggcgatcaccctcgacgatgcgagtgtggaggaggcaaacgag
atctgcacgggaggcaggtgttag

DBGET integrated database retrieval system