KEGG   Methanoculleus marisnigri: Memar_1368Help
Entry
Memar_1368        CDS       T00477                                 

Definition
(GenBank) pyrophosphate-dependent phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
mem  Methanoculleus marisnigri
Pathway
mem00010  Glycolysis / Gluconeogenesis
mem00030  Pentose phosphate pathway
mem00051  Fructose and mannose metabolism
mem00052  Galactose metabolism
mem00680  Methane metabolism
mem01100  Metabolic pathways
mem01110  Biosynthesis of secondary metabolites
mem01120  Microbial metabolism in diverse environments
mem01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mem00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Memar_1368
   00030 Pentose phosphate pathway
    Memar_1368
   00051 Fructose and mannose metabolism
    Memar_1368
   00052 Galactose metabolism
    Memar_1368
  Energy metabolism
   00680 Methane metabolism
    Memar_1368
Enzymes [BR:mem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Memar_1368
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Memar_1368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DUF128 NAD_kinase Peripla_BP_4
Motif
Other DBs
NCBI-ProteinID: ABN57297
UniProt: A3CV97
Position
1359801..1360835
Genome map
AA seq 344 aa AA seqDB search
MTTVGILTGGGDCPGLNAVIRAVVRTGAKHGFDAIGIRDGWLGLVAGNVEPLTDYSVTGI
LPKGGTILGTSRTNPFKNEADVQRLRDNIRKFGIDAIVAIGGEDTLGVANKLSKMGIPVV
GVPKTIDNDVGATDYTFGFDTAVATVTEAIDRLHTTAESHHRVMVVEVMGRHAGWIATVA
GIAGGADEILIPEIPFDLDEVTHHLRARYERGKKFSIVVVAEGAQPKGMAEAIAQSARTD
EFGHVTLGGVGNYLRDELEKRLDMEVRVTVLGHIQRGGSPTAHDRVLATRFGVAAADLIK
EKDFGKMVALRGDDIVAVPLEEAVANLKTVDMDLYKIASIFYGG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgacgacagtcggcatactgacgggaggaggcgactgcccgggcctgaacgcggtgatc
cgggcggtcgtgcggacgggagcgaagcacgggttcgatgcgatcgggatccgggacgga
tggctcgggctggtcgccgggaacgtcgaaccgctcaccgattactcggtgaccgggatc
ctcccgaaaggcgggacgatcctcgggacgtcgcggacgaaccccttcaagaacgaggcc
gacgtccagcggctgcgcgacaacatcaggaagttcgggatcgacgcgatcgttgcgatc
ggcggcgaggataccctgggtgtcgcgaacaaactctcgaagatgggtatcccggtggtg
ggggtcccgaagaccatcgacaacgacgtcggtgcaaccgactacaccttcgggttcgac
accgccgtcgcaaccgtcacggaggcgatcgaccgtctccacacgacggcggagtcgcac
caccgcgtcatggtcgtggaggtgatgggccggcacgccgggtggatcgcgaccgtggcc
gggatcgcgggtggagccgacgagatcctgatcccggagatcccgttcgacctcgacgag
gtcacccaccacctccgggcgcgctacgagcgggggaagaagttcagcatcgtcgtggta
gccgagggcgcccagccgaaggggatggcggaggcgatcgcacagtccgcacggacggac
gagttcggccacgtcaccctcggcggtgtcgggaactacctgcgcgacgaactcgaaaag
aggctcgacatggaggtgcgggtgacggtgctcgggcacatccagcgcggcggctccccg
acggcgcacgaccgggtgctcgcgacccggttcggggtggcggcggcggacctcatcaag
gagaaagacttcgggaagatggtcgcgctccggggggacgatatcgtcgcggtcccgctc
gaagaggcggtggcgaacctcaagaccgtggatatggacctctacaagatcgcgagcatc
ttttacggggggtga

DBGET integrated database retrieval system