KEGG   Methanoculleus marisnigri: Memar_1368Help
Entry
Memar_1368        CDS       T00477                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mem  Methanoculleus marisnigri
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mem00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Memar_1368
   01230 Biosynthesis of amino acids
    Memar_1368
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Memar_1368
   00030 Pentose phosphate pathway
    Memar_1368
   00051 Fructose and mannose metabolism
    Memar_1368
   00052 Galactose metabolism
    Memar_1368
  Energy metabolism
   00680 Methane metabolism
    Memar_1368
Enzymes [BR:mem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Memar_1368
Protein phosphatases and associated proteins [BR:mem01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Memar_1368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1359801..1360835
Genome map
AA seq 344 aa AA seqDB search
MTTVGILTGGGDCPGLNAVIRAVVRTGAKHGFDAIGIRDGWLGLVAGNVEPLTDYSVTGI
LPKGGTILGTSRTNPFKNEADVQRLRDNIRKFGIDAIVAIGGEDTLGVANKLSKMGIPVV
GVPKTIDNDVGATDYTFGFDTAVATVTEAIDRLHTTAESHHRVMVVEVMGRHAGWIATVA
GIAGGADEILIPEIPFDLDEVTHHLRARYERGKKFSIVVVAEGAQPKGMAEAIAQSARTD
EFGHVTLGGVGNYLRDELEKRLDMEVRVTVLGHIQRGGSPTAHDRVLATRFGVAAADLIK
EKDFGKMVALRGDDIVAVPLEEAVANLKTVDMDLYKIASIFYGG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgacgacagtcggcatactgacgggaggaggcgactgcccgggcctgaacgcggtgatc
cgggcggtcgtgcggacgggagcgaagcacgggttcgatgcgatcgggatccgggacgga
tggctcgggctggtcgccgggaacgtcgaaccgctcaccgattactcggtgaccgggatc
ctcccgaaaggcgggacgatcctcgggacgtcgcggacgaaccccttcaagaacgaggcc
gacgtccagcggctgcgcgacaacatcaggaagttcgggatcgacgcgatcgttgcgatc
ggcggcgaggataccctgggtgtcgcgaacaaactctcgaagatgggtatcccggtggtg
ggggtcccgaagaccatcgacaacgacgtcggtgcaaccgactacaccttcgggttcgac
accgccgtcgcaaccgtcacggaggcgatcgaccgtctccacacgacggcggagtcgcac
caccgcgtcatggtcgtggaggtgatgggccggcacgccgggtggatcgcgaccgtggcc
gggatcgcgggtggagccgacgagatcctgatcccggagatcccgttcgacctcgacgag
gtcacccaccacctccgggcgcgctacgagcgggggaagaagttcagcatcgtcgtggta
gccgagggcgcccagccgaaggggatggcggaggcgatcgcacagtccgcacggacggac
gagttcggccacgtcaccctcggcggtgtcgggaactacctgcgcgacgaactcgaaaag
aggctcgacatggaggtgcgggtgacggtgctcgggcacatccagcgcggcggctccccg
acggcgcacgaccgggtgctcgcgacccggttcggggtggcggcggcggacctcatcaag
gagaaagacttcgggaagatggtcgcgctccggggggacgatatcgtcgcggtcccgctc
gaagaggcggtggcgaacctcaagaccgtggatatggacctctacaagatcgcgagcatc
ttttacggggggtga

DBGET integrated database retrieval system