KEGG   Methanoculleus marisnigri: Memar_1389Help
Entry
Memar_1389        CDS       T00477                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mem  Methanoculleus marisnigri
Pathway
mem00010  Glycolysis / Gluconeogenesis
mem00620  Pyruvate metabolism
mem00640  Propanoate metabolism
mem00680  Methane metabolism
mem00720  Carbon fixation pathways in prokaryotes
mem01100  Metabolic pathways
mem01110  Biosynthesis of secondary metabolites
mem01120  Microbial metabolism in diverse environments
mem01130  Biosynthesis of antibiotics
mem01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mem00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Memar_1389
   00620 Pyruvate metabolism
    Memar_1389
   00640 Propanoate metabolism
    Memar_1389
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Memar_1389
   00680 Methane metabolism
    Memar_1389
Enzymes [BR:mem01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Memar_1389
Lipid biosynthesis proteins [BR:mem01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Memar_1389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABN57318
UniProt: A3CVB8
Position
complement(1382062..1383960)
Genome map
AA seq 632 aa AA seqDB search
MAEDFNVKLEEAKYYTPEASCREQSWVGDYNQAYREFLADPDGFWDCVAKELEWFQPWDR
VKEWNYPYARWFLNGKLNITHNCLDRHVYNQRRNKVAIMWRGETEEEERILTYRQLFQAV
CRFANGLKRLGVGKGDRVCIYMPVVPEQIVAMLACARIGAIHTVVFGGFGVSALNQRITG
TDAKVVVTADVTYRRGKAIPLKNIVEEAVVNAPSVERIVILRRDDDKPVELHPEMEVDYY
DLMEGVERECPAEPMDAEDPLFILYTSGTTGSPKGIVHTCGGYMVGTYYTTRHVFDVKDN
DIYWCTADPGWITGHSYGVYGPLLNGATCLIAEATPDYPDPGTYWDLIEEYGVTIFYTAP
TAIRMFMRVGEEWPDRYNLSSLRILGSVGEPLNPEAFEWFYRTIGKDRCPIVDTWWQTET
GMHMVTTMIGEPMRPGFAGKPIPGVVADVVDMAGNPCPPGTGGLLVVREPWPSMMRTIWN
DDERYCKYWNTVPGCYTAADLAVKDKDGYIMVIGRSDDLIVVAGHNIGTAEVESALVSHE
AVAEAAVIGKPDALKGNTIKAFVILRNGQKPGEKLRNDLVYHVRMTLGPIAIPSEIDFVD
SLPKTRSGKIMRRVLKAQELGMDPGDISTLEE
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagattttaacgtcaaactcgaggaggcgaagtactatacccccgaagccagc
tgcagggagcagtcctgggtcggggactacaaccaggcctaccgggagtttcttgcggac
cccgacgggttctgggactgcgtcgccaaggagcttgagtggttccagccctgggaccgg
gtgaaggagtggaactacccctacgccaggtggttcctcaacggcaaactcaacatcacc
cacaactgcctggatcgccacgtctacaaccagcggcgcaacaaggtcgcgatcatgtgg
cggggagagaccgaagaggaggagcggatcctcacctaccgccagctcttccaggccgtc
tgtcggttcgcaaacggcctgaagcgtctcggcgtcgggaagggcgaccgcgtctgcatc
tacatgccggtggtgcccgaacagatcgtcgccatgctcgcctgcgcccggatcggggcc
atccacacggtcgtcttcggcgggttcggcgtcagtgcactcaatcagcgcatcacgggc
accgatgcaaaggtggtcgtcaccgccgacgtcacctaccggcgcggtaaggcaattccg
ctcaagaatatcgtcgaggaggcggtcgtcaacgcaccctccgtcgagcggatcgtcatc
ctccggcgcgacgacgacaagcccgtggagctccaccccgagatggaggtggactactac
gacctgatggagggcgtcgagcgggagtgcccggccgaaccgatggacgccgaagacccg
ctcttcatcctctacacgagcggcaccaccggatccccgaagggcatcgtgcacacctgc
ggcggctacatggtcgggacctactacaccacccgccacgtcttcgacgtcaaggacaac
gacatctactggtgcaccgccgaccccgggtggatcaccggtcacagttacggcgtctac
ggcccgctcctgaacggcgccacctgcctcatcgccgaggccacccccgactacccggat
ccgggcacctactgggacctcatcgaggagtacggcgtcaccatcttctacaccgcaccg
acggccatccggatgttcatgcgggtgggcgaagagtggccggaccgctacaacctctcg
tcgctccgcatcctcgggtcggtcggcgagccgctcaaccccgaggcgttcgagtggttc
taccgcaccatcggcaaagaccggtgcccgatcgtggacacctggtggcagaccgagacc
gggatgcacatggtgaccacgatgatcggcgagccgatgcgccccggattcgccgggaag
ccgatcccgggcgtcgtcgcggacgtcgtcgatatggcgggcaacccgtgtccgccgggc
acgggcggcctcctggtcgtcagggagccctggccgtcgatgatgcgaacgatctggaac
gacgatgagcggtactgcaagtactggaacaccgttcccggctgctacaccgcggccgac
ctcgcggtgaaggacaaggacggctacatcatggtcatcgggcggtccgacgacctgatc
gtcgtcgccgggcacaacatcgggacggccgaggtcgagagcgcgctcgtctcccacgag
gccgtggcggaagccgccgtcatcgggaaacccgacgccctgaaggggaacaccataaaa
gccttcgtcatcctcaggaacggccaaaaacccggcgaaaaactgagaaacgatctcgtc
taccacgtcaggatgacgctcggtcccatcgccataccgtccgagattgacttcgtcgat
tcgctccccaagacccggagcggcaagatcatgaggcgggtcctgaaagcacaggagctg
ggtatggaccccggtgatatctcgactttggaagagtag

DBGET integrated database retrieval system