KEGG   Methanoculleus marisnigri: Memar_1467Help
Entry
Memar_1467        CDS       T00477                                 

Definition
acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mem  Methanoculleus marisnigri
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mem00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Memar_1467
  Amino acid metabolism
   00300 Lysine biosynthesis
    Memar_1467
Enzymes [BR:mem01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Memar_1467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1455183..1456349
Genome map
AA seq 388 aa AA seqDB search
MDVARLASSLIRIRSENPPGSTADVVAFIGEFLDALGVKNRIISHPGGRDNLVTTEPGSR
LLLCGHVDVVPAIPDDWTHDPYSGEVTGGYVWGRGATDMKGGCAALLIACRDLIESGVEP
EVQFAFVCDEETGGEYGIRSLLAQNLLEPRECLIAEPTPETSPAIGQKGLYRIDLSFRGR
PGHSSLYPLVGKSAVMAAFDLLGYLQEVHARPFPVDEDLQPLIEEGARVFSEIFGIEGGD
EILTRVMFNPGRIEGGEKANIVAEQCRMELDIRVPWGCSLESLRSGIAEHAPDAVIRETD
VAEPTLTPPDARIVRTVCREVERVYGTAAPFLQWAASDAKYLRDRGFDVLEYGPGEIPTL
HAVDERVGVEQLEKAVDVYRGVIRAYSS
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggatgttgctcgactcgcttcatcgctcatccggatcaggagcgagaaccccccgggg
agcacggcggatgtcgtcgcgttcatcggggagttcctcgatgcgctcggggtgaagaac
cgcatcatctcgcatcccggcggccgggataacctcgtcacgactgagcccggttcccgg
ctcctcctctgcggccacgtcgacgtcgtccccgccatccccgacgactggacgcacgat
ccctacagcggggaggtcaccggcggttacgtctgggggagaggcgccaccgatatgaaa
gggggatgcgctgctctccttatcgcctgccgcgacctcatcgagagcggggtggagccg
gaggtccagttcgccttcgtctgcgacgaggagaccggcggggagtacgggatccggtcg
ctgctcgcccagaacctgctcgaaccccgcgaatgcctgatcgccgaaccgacgccggag
accagcccggcgatcggccagaaaggcctctaccggatcgacctctccttccgcggcaga
cccggccacagttccctctatcccctggtcgggaagagcgccgtcatggcggcgttcgac
ctcctcggctacctccaagaggttcacgcccgcccgttccccgtcgatgaagacctgcag
ccgcttatcgaggagggtgcccgggtcttctccgagatcttcgggatcgagggaggggat
gagatcctgacccgggtgatgttcaaccccggacgcatcgagggcggcgagaaggcgaac
atcgtggcggagcagtgccggatggaactcgacatccgggtgccgtggggctgctccctc
gagagcctgcggagtgggatcgccgaacacgccccggacgccgtgatacgcgagacggac
gtggccgaaccgaccctgacgcccccggacgcccggattgtccggacggtctgtcgcgag
gtggagcgggtctacgggacggcagcccccttcctccagtgggcggcaagcgacgcgaag
tacctccgcgacagggggttcgatgttctggagtacgggccgggggagatcccgacgctg
cacgcggtggacgagcgggtcggcgttgagcagctcgagaaggcagtggatgtctaccgg
ggcgtcatccgggcgtactcttcatga

DBGET integrated database retrieval system