KEGG   Methanoculleus marisnigri: Memar_1505Help
Entry
Memar_1505        CDS       T00477                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mem  Methanoculleus marisnigri
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mem00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1506671..1507708)
Genome map
AA seq 345 aa AA seqDB search
MVKELLRKLSDAHGVSSSEGNIRDIVRAELAGVVDEFREDTMGNLVAVKRGDDFSIMIAA
HMDEIGLMVQYIDEKGFIRVVPIGGWYGPVLYCQRVVLHGKNGPVPGVLGAKPPHVMKEE
ERKKEIKIENLFVDVGATSEEEVKNLGIEIGTPITIDREFTDLAGTRVTGKALDNRVGVA
MLIRALQQADSPHTIYGVFTVQEELGLKGAKVSAYSLNPDCAIATDVTIPGDHPGIEKKD
ASVEMGKGPVLVLVSASGRGLMADPRMTAWLRETAEKNDIPCQLEVGTGGNTDATIIHLE
RGGIPSIPLSIAARYIHSPVEVVDAADVEAGVRLLVEALKGKPAL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaagagttactcaggaagctatccgacgcccacggcgtctcgagcagcgaagga
aacataagggatatcgtcagggcggaacttgcaggggtggtcgacgagttccgcgaggac
acgatggggaacctggttgccgtgaagcgcggcgacgacttctccatcatgattgccgcc
cacatggacgagatcggcctgatggtgcagtacatcgacgagaaggggttcatccgggtc
gtccccatcgggggctggtacgggccggtgctctactgccagcgggtggtgctgcacggg
aagaacggcccggtcccgggcgtcctcggcgcaaagcccccccacgtcatgaaggaggag
gagcgcaagaaagagatcaagatcgagaatctgttcgtcgacgtgggcgcgacgagcgag
gaggaggtgaagaacctcgggatcgagatcggcaccccgatcaccatcgaccgcgagttc
acggaccttgccggcacccgcgtcacgggcaaagcgctcgataaccgggtcggtgtcgcg
atgctcatccgggcgctgcagcaggcggactccccgcacacgatctacggcgtcttcacc
gtccaggaggagctggggctcaaaggcgcgaaggtgagcgcctactccttaaaccccgac
tgcgcgatcgcgaccgacgtcaccattcccggcgaccaccccgggatcgagaagaaggac
gcgagcgtcgagatgggcaagggcccggtcctggttctcgtcagcgcgagcgggcgcggg
ctgatggccgatccgaggatgaccgcgtggctccgcgagaccgcggagaagaacgacatc
ccctgccagctcgaggtcggcaccggcggcaacaccgacgcgacgatcatccacctggag
cggggcggtatcccgagcatcccgctctcgatcgccgcccgctacatccactccccggtc
gaggtggtcgatgccgccgacgtcgaggcgggggtccggctcctcgtcgaggcgctgaag
ggcaaacctgcgctctga

DBGET integrated database retrieval system