KEGG   Methanoculleus marisnigri: Memar_1563Help
Entry
Memar_1563        CDS       T00477                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mem  Methanoculleus marisnigri
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mem00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Memar_1563
   01230 Biosynthesis of amino acids
    Memar_1563
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Memar_1563
   00030 Pentose phosphate pathway
    Memar_1563
   00051 Fructose and mannose metabolism
    Memar_1563
  Energy metabolism
   00680 Methane metabolism
    Memar_1563
Enzymes [BR:mem01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Memar_1563
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Memar_1563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1569019..1570116
Genome map
AA seq 365 aa AA seqDB search
MVKTTVSVIKADIGSFPGHSRTHPKILEVAARRLKEAEGSILIDSYVTHCGDDLELIMTH
TKGEDNEEIHKLAWDIFMECAGLAKEMKLYGAGQDLLGDAFSGNVKGMGPGVAEMEFEER
GSDPILVFMADKTEPGAWNYFLYKIFADPFSTSGLVIDPSLHDGFTFEVHDVIKKRKILF
NTPEESYSLLAYIGAPSRYVIKYVWKRNGLIGASTSTQRLNLMAGRYVGKDDPVMIVRAQ
SGFPAVGEVIDPFRTPILVAGWMRGSHHGPFMPVGVCDANCTQFDGPPRVICLGFQVCNG
KLIGPADMFDDPAYNRVRDQCCELSSLLRAHGPFEPHRLSLEEMEYTTLPGVEKQFKDRW
EDLPE
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggttaagaccaccgtgtccgtaattaaagcagatataggcagtttcccggggcactcc
cgaacccacccgaagatccttgaggtggccgcccggagactcaaggaagcggaaggaagc
atcctcatcgactcgtacgtcacccactgcggtgacgatctcgagttgatcatgacgcac
accaaaggggaggacaatgaagagatccacaagctggcgtgggatatcttcatggagtgc
gccggactcgccaaggagatgaaactctacggcgccgggcaggacctgctcggagatgcg
ttcagcggcaacgtcaaggggatgggacccggtgtcgccgagatggagttcgaagagcgg
ggttccgacccgatcctggtcttcatggccgacaagaccgagccgggggcgtggaactac
ttcctctacaagatattcgccgaccccttcagcacgtccggcctcgtcatcgacccgtcg
ctgcacgatgggttcaccttcgaggtccacgacgtcataaagaagcgcaagatcctcttc
aacacgcccgaagagtcctacagcctccttgcctatatcggagcgccgagccgctacgtc
atcaagtacgtctggaagagaaacggcctgataggggcgtccaccagcacccagcggctg
aacctgatggccgggcggtacgtcggcaaagacgacccggtcatgattgttcgggcacag
agcggattcccggcggtgggcgaggtcatcgaccccttcaggacgcccatcctcgtggcc
ggctggatgcggggctcgcaccacggaccgttcatgcccgtcggcgtctgcgacgcaaac
tgcacccagttcgacggaccgccccgggtcatctgcctcgggttccaggtctgcaacgga
aagctgattgggcctgccgacatgttcgacgacccggcgtacaaccgcgtccgcgaccag
tgctgcgagctctccagcttgctccgggctcacgggccgttcgaaccgcaccgcctctcg
ctcgaggagatggagtacaccaccctcccgggcgtcgagaagcagttcaaggatcgctgg
gaagaccttcccgagtaa

DBGET integrated database retrieval system