KEGG   Methanoculleus marisnigri: Memar_1563Help
Entry
Memar_1563        CDS       T00477                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mem  Methanoculleus marisnigri
Pathway
mem00010  Glycolysis / Gluconeogenesis
mem00030  Pentose phosphate pathway
mem00051  Fructose and mannose metabolism
mem00680  Methane metabolism
mem01100  Metabolic pathways
mem01110  Biosynthesis of secondary metabolites
mem01120  Microbial metabolism in diverse environments
mem01130  Biosynthesis of antibiotics
mem01200  Carbon metabolism
mem01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mem00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Memar_1563
   00030 Pentose phosphate pathway
    Memar_1563
   00051 Fructose and mannose metabolism
    Memar_1563
  Energy metabolism
   00680 Methane metabolism
    Memar_1563
Enzymes [BR:mem01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Memar_1563
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Memar_1563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: ABN57492
UniProt: A3CVU2
Position
1569019..1570116
Genome map
AA seq 365 aa AA seqDB search
MVKTTVSVIKADIGSFPGHSRTHPKILEVAARRLKEAEGSILIDSYVTHCGDDLELIMTH
TKGEDNEEIHKLAWDIFMECAGLAKEMKLYGAGQDLLGDAFSGNVKGMGPGVAEMEFEER
GSDPILVFMADKTEPGAWNYFLYKIFADPFSTSGLVIDPSLHDGFTFEVHDVIKKRKILF
NTPEESYSLLAYIGAPSRYVIKYVWKRNGLIGASTSTQRLNLMAGRYVGKDDPVMIVRAQ
SGFPAVGEVIDPFRTPILVAGWMRGSHHGPFMPVGVCDANCTQFDGPPRVICLGFQVCNG
KLIGPADMFDDPAYNRVRDQCCELSSLLRAHGPFEPHRLSLEEMEYTTLPGVEKQFKDRW
EDLPE
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggttaagaccaccgtgtccgtaattaaagcagatataggcagtttcccggggcactcc
cgaacccacccgaagatccttgaggtggccgcccggagactcaaggaagcggaaggaagc
atcctcatcgactcgtacgtcacccactgcggtgacgatctcgagttgatcatgacgcac
accaaaggggaggacaatgaagagatccacaagctggcgtgggatatcttcatggagtgc
gccggactcgccaaggagatgaaactctacggcgccgggcaggacctgctcggagatgcg
ttcagcggcaacgtcaaggggatgggacccggtgtcgccgagatggagttcgaagagcgg
ggttccgacccgatcctggtcttcatggccgacaagaccgagccgggggcgtggaactac
ttcctctacaagatattcgccgaccccttcagcacgtccggcctcgtcatcgacccgtcg
ctgcacgatgggttcaccttcgaggtccacgacgtcataaagaagcgcaagatcctcttc
aacacgcccgaagagtcctacagcctccttgcctatatcggagcgccgagccgctacgtc
atcaagtacgtctggaagagaaacggcctgataggggcgtccaccagcacccagcggctg
aacctgatggccgggcggtacgtcggcaaagacgacccggtcatgattgttcgggcacag
agcggattcccggcggtgggcgaggtcatcgaccccttcaggacgcccatcctcgtggcc
ggctggatgcggggctcgcaccacggaccgttcatgcccgtcggcgtctgcgacgcaaac
tgcacccagttcgacggaccgccccgggtcatctgcctcgggttccaggtctgcaacgga
aagctgattgggcctgccgacatgttcgacgacccggcgtacaaccgcgtccgcgaccag
tgctgcgagctctccagcttgctccgggctcacgggccgttcgaaccgcaccgcctctcg
ctcgaggagatggagtacaccaccctcccgggcgtcgagaagcagttcaaggatcgctgg
gaagaccttcccgagtaa

DBGET integrated database retrieval system