KEGG   Methanoculleus marisnigri: Memar_1876Help
Entry
Memar_1876        CDS       T00477                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mem  Methanoculleus marisnigri
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mem01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:mem00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1872186..1873436)
Genome map
AA seq 416 aa AA seqDB search
MWQALDIETWIAGRRSDIDRVKGPVSEIIGRVREEGDAALLDLTKRFDKIDLEEIAVPDE
EREAAYDEVDARLVESLVEAEERISRFHELQRGRDLWLQEMEPGITLGVKTTPLSRIGAY
VPGGRAAYPSTALMCTIPAKVAGVAEICCCTPPPTSPITLVALDIAGVDEVYRVGGAQAI
AAMALGTESVPRVEKIVGPGNVYVTAAKMLLRDEAEIDFPAGPSEIAILADGTANPTFIA
ADILAQAEHDPNAACVLVTTDAALAGAVGAEVKRMAGEAKRRDIVAKALEHSGYIVAGDL
DEAVATVDGIAPEHLSVQMADPLAVINRIRSAGSIFVGPYAAVACGDYASGTNHVLPTAG
YARLYSGLDVNHFCRRSTVQVITREGLEAIGDVVETIADAEGLHAHAESVRVRRRG
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgtggcaggcgctggatatcgagacctggatcgccgggcggcggtcggacatcgaccgg
gtgaagggaccggtctcggagatcatcgggagggtgcgagaggagggcgacgccgccctg
ctcgacctgacgaagaggttcgataagatcgatctcgaggagatcgccgtccccgacgag
gagcgggaggcggcctacgatgaggtggacgcacggctggtcgaaagtctcgtggaggcg
gaggagcggatcagccggttccacgaactgcagcgcggacgcgacctctggctgcaggag
atggagcccgggatcaccctcggcgtcaagacgactccgctctcccgtatcggcgcctac
gtccccggcgggcgggcggcctacccctcgacggcgctgatgtgcacgatcccggcgaag
gtcgcgggggtcgcggagatctgctgctgcaccccgccgccgacgagcccgatcaccctc
gtcgcgctcgatatcgccggggtcgacgaggtctaccgggtcggcggcgcccaggcgatc
gcggcaatggcgctcgggacggagtcggtcccacgggtggagaagatcgtcggcccgggg
aacgtctacgtcaccgccgcgaagatgcttctgcgcgacgaggctgagatagacttcccg
gcaggaccgagcgagattgcgatcctcgctgacggcacggcgaacccgaccttcatcgcg
gccgatatccttgcccaggccgagcacgacccgaacgccgcctgcgtcctggtgaccacc
gacgcggccctcgccggtgcagtcggtgccgaggtgaagcggatggccggggaggcgaaa
cgccgcgatatcgtcgcaaaggcgctcgagcactccggctacatcgttgccggcgatctc
gacgaagcggtcgcgaccgtcgacggcatcgcccccgagcacctctcggtccagatggcc
gacccgctcgccgtcatcaaccgcatccggagcgccgggtcgatattcgtcggcccctac
gcggcggtagcctgcggcgactatgcctcggggacgaaccacgtcctcccgacggctggc
tacgctcggctctactccggcctcgacgtgaaccacttctgccggcgctcgacggtgcag
gtgatcacgcgggaggggcttgaggccatcggcgacgttgtggagacgatcgccgacgcg
gaggggctccacgcccacgcggagtcggtacgggtgcggagaaggggataa

DBGET integrated database retrieval system