KEGG   Methanoculleus marisnigri: Memar_2046Help
Entry
Memar_2046        CDS       T00477                                 

Definition
ELP3 family histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mem  Methanoculleus marisnigri
Brite
Enzymes [BR:mem01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Memar_2046
Transfer RNA biogenesis [BR:mem03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Memar_2046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2038849..2040441
Genome map
AA seq 530 aa AA seqDB search
MPGVRKLQGPQDLPQPAAGQEVPRRYRPHDQKIKLEVCREHGASMPKNSAVLAAAAPDER
ERLRPILQVKPTRTLSGVAPVAVMTSPHPCPHGKCLPCPGGPEHPFASPQSYTGEEPAAL
RAREHAFDPYAQVQARLGQFEALGHHVDKAELIVMGGTMTARPLEYQEWFVGAAVQAMND
YPRAGAPQEKPDLEAIFAANESARVRCVAATFETRPDWCREEHIDRMLSMGVTKVELGVQ
HVDDRLLDYNRRGHAVADSVAANCLLRDAGLKVGFHMMPNLPAASIEDDRRMFRELFADP
RFRPDFLKIYPTLVTPGSEIEALWERGEYLPYTEEVLIDLVAYAKSLLPEYVRLQRIQRD
IPAKLIVAGSRHSNFRQLAEARLHEQGLRCRCIRCREVGRSPEPEEVAISTLVYQACGGE
ERFIQAGSEDGLVGFARLRFPHNPFRDELADAALLRELHVYGSVVPISTPASADEWQHRS
FGSVLLSAAEEEARDHGYRRLAVMSGVGVRPYYRKQGYERVGPYMIKTFP
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
gtgcccggagtgcgaaaactgcaaggtccgcaagacctgccacaacctgcagccgggcag
gaggtaccgcgtcgctaccgtccgcacgaccagaagatcaaactcgaggtctgccgcgag
cacggtgcgagcatgcccaaaaactccgcggtcctcgccgccgccgcccccgatgagcgc
gagcggctccggccgatcctccaggtgaaacccacccggaccctctccggggtggcgccc
gttgcggtgatgacctcgccccacccctgcccccacgggaagtgcctcccctgccccggc
gggccggagcatccctttgcatccccccagagttacacgggagaagagcccgcggcgctc
cgggcgagagagcacgccttcgacccctacgcccaggtgcaggcccgcctcgggcagttc
gaggcgctcggtcaccacgtcgacaaggcggaactgatcgtgatgggcgggacgatgacc
gcccgcccgctcgagtaccaggagtggttcgtcggggccgccgtgcaggcgatgaacgac
tacccgcgggccggggctccgcaggagaagcccgatctcgaggcgatctttgccgcgaac
gagtcggcacgggtccggtgcgtcgccgccaccttcgagacgaggccggactggtgccgg
gaggagcatatcgaccggatgctctcgatgggcgtgaccaaggtggaactcggcgtccag
cacgtggacgaccggctcctcgactacaaccgccgcggccatgcggtcgcggactcggtc
gcggcgaactgcctcctgcgcgacgccggactgaaggtcgggttccacatgatgccgaac
ctccccgcggcgagcattgaggacgaccggcggatgtttcgggaactcttcgctgatccg
cggttccggccggacttcctgaagatctacccgaccctggtgacgccgggctcagagatc
gaggcgctctgggaacggggagagtatctgccctacaccgaggaagtactgatcgacctc
gtcgcctacgcgaagtctctcctcccggagtacgtccgtctccagcggatccagcgggat
atcccggcaaagctgatcgtcgcgggttcacggcatagcaacttccgccagcttgccgag
gcgcggctccatgagcaggggcttcgctgccggtgcatccgctgccgcgaggtgggcaga
tcgcccgaaccggaggaggtggcgatctcgaccctggtttaccaggcgtgcggcggagag
gagaggttcattcaggcgggctccgaggacggcctcgtcgggttcgcccggctccggttc
ccgcacaaccccttccgcgacgaactcgcggacgccgcgctcctgcgcgagctccatgtc
tacgggagcgtggtgccgatcagcactccggcatccgccgacgagtggcagcaccgcagt
ttcggcagcgttctcctctccgcggccgaagaggaggcacgcgatcacggctaccggcgc
ctcgcggtgatgagtggtgtcggggtgcggccctactacaggaaacagggatatgaacga
gtgggcccatatatgatcaagacgttcccatga

DBGET integrated database retrieval system