KEGG   Methanoculleus marisnigri: Memar_2318Help
Entry
Memar_2318        CDS       T00477                                 

Definition
thiamine pyrophosphate binding domain-containing protein
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
mem  Methanoculleus marisnigri
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mem00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Memar_2318
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Memar_2318
   00020 Citrate cycle (TCA cycle)
    Memar_2318
   00620 Pyruvate metabolism
    Memar_2318
   00640 Propanoate metabolism
    Memar_2318
   00650 Butanoate metabolism
    Memar_2318
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Memar_2318
   00680 Methane metabolism
    Memar_2318
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Memar_2318
Enzymes [BR:mem01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Memar_2318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2305688..2306602
Genome map
AA seq 304 aa AA seqDB search
MTNINARSVTNLSAIPKEEYLYKCTSACAGCSSSLCLRYVLKAAGPDSVLVVPACCTSVI
QGIYPATAMNVPVYNVAFAAAAACASGMSEAFAAMGRETNVIVYAGDGGTVDIGIQALSG
AFERGTNFLYICYDNEAYGNTGMQRSGSTPLGARTTTTPGGKPTTKKDLDRIVEAHNPPY
MATACSAYPLDLYKKVEKALSIEGPKFIHILAPCPPGWRYPTEKTVEMGKLAVKTGTWIL
YEREFGKLSISGPSKAAMKRPAPLEDYIGGQGRFKNLSPETLDLMRQQVQQSIQRLSREE
AGVC
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatataaacgcgaggagtgtaaccaatttgtcagcgattccaaaggaggagtat
ctctataagtgcacgtccgcctgcgcggggtgcagctcttccctgtgtctgcgttacgtg
ctcaaagccgccggacccgactccgtcctggtcgtacccgcctgctgcaccagcgttatc
caggggatttaccccgccacggcgatgaacgtgcccgtctacaacgtggcgtttgcagca
gccgcagcctgcgcctccggtatgagcgaggcgtttgcggcaatggggagagagaccaac
gtcatcgtctacgcgggcgacggcggcacggtcgatatcgggattcaggccctctccggc
gctttcgagcgcggcaccaatttcctgtacatctgctacgacaacgaggcatacggcaac
accggcatgcagcggtcgggttcgacaccgctcggggcgcgcaccaccacgactcccggc
ggcaagcccacgaccaagaaagacctcgacaggatcgtcgaggcgcacaacccgccctac
atggcgaccgcctgcagcgcctaccccctcgatctctacaagaaggtcgagaaggcgctc
tcgatcgaggggcccaagttcatccacatcctcgcaccgtgcccgccggggtggcgctac
cccacggagaagacggtcgagatggggaaactcgccgtgaagaccgggacatggatcctc
tacgagcgcgagttcgggaaactctcgatcagcggcccgtcgaaggcggcgatgaagcgg
ccggcgcctctcgaggactacatcgggggccagggccggttcaagaacctgagccccgag
accctcgatctgatgcgccagcaggtgcagcagagcatccagcggctctcccgcgaggag
gcaggcgtatgctga

DBGET integrated database retrieval system