KEGG   Methanoculleus marisnigri: Memar_2319Help
Entry
Memar_2319        CDS       T00477                                 

Definition
pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
mem  Methanoculleus marisnigri
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mem00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Memar_2319
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Memar_2319
   00020 Citrate cycle (TCA cycle)
    Memar_2319
   00620 Pyruvate metabolism
    Memar_2319
   00640 Propanoate metabolism
    Memar_2319
   00650 Butanoate metabolism
    Memar_2319
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Memar_2319
   00680 Methane metabolism
    Memar_2319
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Memar_2319
Enzymes [BR:mem01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Memar_2319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2306596..2307708
Genome map
AA seq 370 aa AA seqDB search
MLTIATGNRAVADAVKAAKPGVIAAYPITPQTEIVEQIAEYVTAGDLESRYIPVESEHSA
MAACIGASVGGVRTFTATSSHGLLYMHEMVHWAAGARLPIVMANVNRALGPGWNTWAEHT
DAFSQRDTGWLQVFVGTVQEAYDATLMAFKIAEDERVLLPVMVNLDGFTLSHITQSLDTM
EIGDFLPPFHLPHAIDTANPLGYGPMTGPADHFRFRWDIERSMRDSRGVIAEVEREFAER
FGRSYGPTEDYRCEDADVVVVAMGTLGKEAEVAIDRLRDEGIRAGSMRLRWFRPFPDLDL
AGRDVVVIDRDYSFGFGGVVAHSIRSKTGVEPYSVIAGLGGQEVTYNDIADFVRNRHPGE
EMWFGVSDHV
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgatcgcgaccggcaacagggcggtggccgacgcggtgaaggccgcgaaaccc
ggcgtcatcgccgcatacccgatcaccccccagaccgagatcgtcgagcagatcgccgag
tacgtcaccgccggcgatcttgaaagccgctacatcccggtggagagcgagcactcggcg
atggcggcctgcatcggggcgagcgtcgggggcgtccggacgttcacggcaacgagttct
catggcctcctctacatgcacgagatggttcactgggccgcgggcgcacgcctgccgatc
gtgatggcgaacgtcaaccgcgccctcgggcctggatggaacacctgggcggagcacacc
gacgccttttcccagcgcgacacgggctggctgcaggtcttcgtgggcaccgtccaggag
gcctacgacgccaccctgatggcgttcaagatcgccgaggacgagagggttctcctcccg
gtgatggtcaacctggacgggttcacgctcagccacatcacgcagtcgctcgatacaatg
gagatcggcgacttcctgccgcccttccacctcccgcacgccatcgacacggcaaacccc
ctcggctacgggcccatgaccgggccggccgaccacttccggttccggtgggacatcgag
cgctcgatgcgcgactcccggggcgtgatcgcggaagtcgagcgtgagtttgcggagcgg
ttcggccgttcctacggccccaccgaggactaccgctgcgaggacgccgacgtcgtcgtc
gtcgcgatgggaaccctcggcaaagaggcggaggtggcgatcgaccgcctccgcgacgaa
gggatcagggccggttccatgcgcctgcgctggttccgtcccttcccggacctcgatctc
gccgggcgcgacgtcgtggtgatcgaccgcgactactcattcggcttcggcggcgtggtg
gcgcactcgatccggtcgaagaccggcgtcgagccctacagcgtgatcgccggcctcggc
ggccaggaggtcacttacaacgatatcgcggactttgtccggaaccgccatccgggcgag
gagatgtggttcggggtgagcgaccatgtatga

DBGET integrated database retrieval system