KEGG   Methanoculleus marisnigri: Memar_2319Help
Entry
Memar_2319        CDS       T00477                                 

Definition
pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
mem  Methanoculleus marisnigri
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mem00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Memar_2319
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Memar_2319
   00020 Citrate cycle (TCA cycle)
    Memar_2319
   00620 Pyruvate metabolism
    Memar_2319
   00640 Propanoate metabolism
    Memar_2319
   00650 Butanoate metabolism
    Memar_2319
  Energy metabolism
   00680 Methane metabolism
    Memar_2319
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Memar_2319
Enzymes [BR:mem01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Memar_2319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2306596..2307708
Genome map
AA seq 370 aa AA seqDB search
MLTIATGNRAVADAVKAAKPGVIAAYPITPQTEIVEQIAEYVTAGDLESRYIPVESEHSA
MAACIGASVGGVRTFTATSSHGLLYMHEMVHWAAGARLPIVMANVNRALGPGWNTWAEHT
DAFSQRDTGWLQVFVGTVQEAYDATLMAFKIAEDERVLLPVMVNLDGFTLSHITQSLDTM
EIGDFLPPFHLPHAIDTANPLGYGPMTGPADHFRFRWDIERSMRDSRGVIAEVEREFAER
FGRSYGPTEDYRCEDADVVVVAMGTLGKEAEVAIDRLRDEGIRAGSMRLRWFRPFPDLDL
AGRDVVVIDRDYSFGFGGVVAHSIRSKTGVEPYSVIAGLGGQEVTYNDIADFVRNRHPGE
EMWFGVSDHV
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgatcgcgaccggcaacagggcggtggccgacgcggtgaaggccgcgaaaccc
ggcgtcatcgccgcatacccgatcaccccccagaccgagatcgtcgagcagatcgccgag
tacgtcaccgccggcgatcttgaaagccgctacatcccggtggagagcgagcactcggcg
atggcggcctgcatcggggcgagcgtcgggggcgtccggacgttcacggcaacgagttct
catggcctcctctacatgcacgagatggttcactgggccgcgggcgcacgcctgccgatc
gtgatggcgaacgtcaaccgcgccctcgggcctggatggaacacctgggcggagcacacc
gacgccttttcccagcgcgacacgggctggctgcaggtcttcgtgggcaccgtccaggag
gcctacgacgccaccctgatggcgttcaagatcgccgaggacgagagggttctcctcccg
gtgatggtcaacctggacgggttcacgctcagccacatcacgcagtcgctcgatacaatg
gagatcggcgacttcctgccgcccttccacctcccgcacgccatcgacacggcaaacccc
ctcggctacgggcccatgaccgggccggccgaccacttccggttccggtgggacatcgag
cgctcgatgcgcgactcccggggcgtgatcgcggaagtcgagcgtgagtttgcggagcgg
ttcggccgttcctacggccccaccgaggactaccgctgcgaggacgccgacgtcgtcgtc
gtcgcgatgggaaccctcggcaaagaggcggaggtggcgatcgaccgcctccgcgacgaa
gggatcagggccggttccatgcgcctgcgctggttccgtcccttcccggacctcgatctc
gccgggcgcgacgtcgtggtgatcgaccgcgactactcattcggcttcggcggcgtggtg
gcgcactcgatccggtcgaagaccggcgtcgagccctacagcgtgatcgccggcctcggc
ggccaggaggtcacttacaacgatatcgcggactttgtccggaaccgccatccgggcgag
gagatgtggttcggggtgagcgaccatgtatga

DBGET integrated database retrieval system