KEGG   Methanoculleus marisnigri: Memar_2320Help
Entry
Memar_2320        CDS       T00477                                 

Definition
pyruvate/ketoisovalerate oxidoreductase, gamma subunit
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
mem  Methanoculleus marisnigri
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mem00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Memar_2320
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Memar_2320
   00020 Citrate cycle (TCA cycle)
    Memar_2320
   00620 Pyruvate metabolism
    Memar_2320
   00640 Propanoate metabolism
    Memar_2320
   00650 Butanoate metabolism
    Memar_2320
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Memar_2320
   00680 Methane metabolism
    Memar_2320
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Memar_2320
Enzymes [BR:mem01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Memar_2320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2307701..2308228
Genome map
AA seq 175 aa AA seqDB search
MYEIRIHSRGGQGGVTAAKLLALAAFRDGKHATACPFYGAERRGAPVVSFVRIDDEPIKV
YSQIHEPDLVIVLDTSIMDVVDVLDGLKADGTVLLNSAHPVAGCNGTCRHVDLTGIALAQ
NLVVAGSPILNTPVLGALAKVGIVTLPSALQAIREMFADERNVKAAEAAYEELKV
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtatgagatcaggatccactcccggggcgggcagggcggcgtcaccgccgcgaagctc
ctcgccctcgcggcgttcagggacggaaagcacgcgaccgcctgcccgttctacggggct
gagcggcgcggggcgccggtcgtctcgttcgtccggatcgacgacgaaccaatcaaggta
tatagccagatccacgagccggatctcgtgatcgtgctcgacacgagcatcatggacgtg
gtggacgttctggacggcctcaaggccgacgggacggttctcttaaacagcgcccatccg
gttgccgggtgcaacggaacctgccgtcacgtcgacctgaccgggatcgcgcttgcacag
aacctggtggtcgcgggaagcccgatcctcaacaccccggtactcggggcgctcgcgaag
gtgggaatcgtcacccttccgtcggcactgcaggcgatccgggagatgtttgccgacgag
cggaacgtgaaagctgctgaagcggcatacgaggagctgaaggtatga

DBGET integrated database retrieval system