KEGG   Methanoculleus marisnigri: Memar_2321Help
Entry
Memar_2321        CDS       T00477                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
mem  Methanoculleus marisnigri
Pathway
mem00010  Glycolysis / Gluconeogenesis
mem00020  Citrate cycle (TCA cycle)
mem00620  Pyruvate metabolism
mem00640  Propanoate metabolism
mem00650  Butanoate metabolism
mem00680  Methane metabolism
mem00720  Carbon fixation pathways in prokaryotes
mem01100  Metabolic pathways
mem01120  Microbial metabolism in diverse environments
mem01130  Biosynthesis of antibiotics
mem01200  Carbon metabolism
Module
mem_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mem_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mem00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Memar_2321
   00020 Citrate cycle (TCA cycle)
    Memar_2321
   00620 Pyruvate metabolism
    Memar_2321
   00640 Propanoate metabolism
    Memar_2321
   00650 Butanoate metabolism
    Memar_2321
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Memar_2321
   00680 Methane metabolism
    Memar_2321
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Memar_2321
Enzymes [BR:mem01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Memar_2321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_7 Fer4_2 Fer4_16 Fer4_21 Fer4_9 Fer4_8 Fer4_17 Fer4_15 Fer4_10 Fer4_13 Fer4_22 Fer4_4 Fer4_18 Fer4_3
Motif
Other DBs
NCBI-ProteinID: ABN58244
UniProt: A3CXZ4
Position
2308225..2308470
Genome map
AA seq 81 aa AA seqDB search
MRERLALSRPKEAASGKTGTWRTFRPVVDRETCNACGLCAQYCPDGVIDEDLNIDLDYCK
GCGICANECPKQAIAMVREER
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atgagagagagacttgcgctcagcaggccgaaagaggccgcgtcggggaagaccgggacg
tggcggacgttccggcccgttgtggatagggagacgtgcaacgcctgcgggctctgcgcc
cagtactgcccggacggggtcatcgacgaagacctcaacattgacctcgactactgcaag
gggtgcggcatctgcgcgaacgagtgcccgaaacaggcgatcgctatggttcgggaggag
cgctga

DBGET integrated database retrieval system