KEGG   Candidatus Moranella endobia PCIT: MEPCIT_087Help
Entry
MEPCIT_087        CDS       T01562                                 

Gene name
sucC
Definition
putative succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
men  Candidatus Moranella endobia PCIT
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:men00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MEPCIT_087 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MEPCIT_087 (sucC)
   00640 Propanoate metabolism
    MEPCIT_087 (sucC)
   00660 C5-Branched dibasic acid metabolism
    MEPCIT_087 (sucC)
Enzymes [BR:men01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MEPCIT_087 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
101640..102806
Genome map
AA seq 388 aa AA seqDB search
MNVHEYQAKQLFARYGLPTPLGYVCKTLQEAVDFASKIGTGPWVLKCQVHAGGRGKSGGI
RVVKSKQEIRTFMEKWLGKRLVTYQTDKSGQPVNEILVEAATNIAQELYIGAVVDRCTRR
VVFMASTEGGVEIEQVSEDTPHLIHKLTIDPLTGPQHYQGRELAFKLKLSGKQINQFIKI
FMGMATLFWERDLTLIEINPLVITSTGDLLCLDGKLSIDNNALFRQQELREMRDYSQEDE
REVHATKWKLNYVALNGNIGCMVNGAGLAMGTMDIIKLHGGEPANFLDIGGSATKERVTE
AFKIILSDEKVKAVLVNIFGGIVRCDLSADGIISAVSEVGNSIPVVVRLEGNNAALGTKL
LVESGLNIIAATSLTEAAQQVVALVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtacatgaatatcaggcaaaacagctatttgctcggtatggtctgcctactccg
cttggatacgtctgcaaaacgctacaagaagcagtcgattttgcttcaaaaattggcacc
ggtccatgggtgttgaaatgccaagtgcatgcaggtggccgcggtaaatcgggtgggatt
agagtggttaaatcaaaacaagagatcagaaccttcatggaaaagtggcttggaaaacga
ctagtcacctatcagacggacaagtctggtcaaccagttaacgaaattctagtagaagca
gcaactaatatagctcaggaactatatattggagccgtcgtcgaccgttgtacgcgccgc
gtggtcttcatggcatctaccgaaggtggagtagaaattgaacaggtatcagaagatact
ccgcacctgattcataaattaacaattgatccgcttactggtccgcaacattatcaagga
agagagttagcttttaaattaaagctcagtggtaagcaaatcaatcagttcataaaaatc
ttcatgggtatggcgacgctattttgggaacgagatttgacgctgatagaaataaacccg
ttggtgattaccagcactggcgatcttctttgccttgacggtaaactaagcatagacaac
aacgcactattccgccagcaggaactacgcgaaatgcgtgattatagtcaagaggatgaa
cgtgaagtgcacgccaccaagtggaaactgaactatgtggcgcttaacggcaatatcggt
tgtatggttaatggggctggtctagcaatggggacgatggatatcataaaactgcacggc
ggtgaaccagctaacttccttgatattggtggcagtgccactaaggaacgtgtaacagaa
gcgttcaaaataatactttcggatgaaaaggtaaaagcggtgctggtaaatattttcggt
ggtattgtccgctgtgatttaagtgctgatggcatcattagcgcagtatctgaagtaggt
aatagcattccagtagtagttcgtctagaaggtaacaatgccgcactgggaactaaacta
ttagtcgagagcgggcttaatatcattgccgccacaagtctaaccgaagcagcacaacag
gttgtcgcattggtggagggtaagtag

DBGET integrated database retrieval system