KEGG   Candidatus Moranella endobia PCIT: MEPCIT_097Help
Entry
MEPCIT_097        CDS       T01562                                 

Gene name
gpmA
Definition
putative phosphoglyceromutase 1
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
men  Candidatus Moranella endobia PCIT
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:men00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MEPCIT_097 (gpmA)
   01230 Biosynthesis of amino acids
    MEPCIT_097 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MEPCIT_097 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    MEPCIT_097 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MEPCIT_097 (gpmA)
Enzymes [BR:men01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MEPCIT_097 (gpmA)
Exosome [BR:men04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MEPCIT_097 (gpmA)
  Exosomal proteins of melanoma cells
   MEPCIT_097 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
115221..115937
Genome map
AA seq 238 aa AA seqDB search
MMAVTKLVLIRHGESQWNHENRFTGWTDVELSAKGRTESKIAGKILKSAGYKFDVAYTSV
LKRAINTLWYILTELDQVWLPVEKSWRLNERHYGALQGLNKAKTAAKYGDELVKQWRRSL
AIIPPALTIDDQRFPGHDIRYAKLTANELPTTESLALTIDRVLPYWKENILPRMKNGERV
IITAHGNSIRAMVKFLDNLSEEVITELNIPTGIPLVYEFDKNIQVINHYYLGNADEIA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgatggctgtaactaagctagttctaatacgtcacggtgaaagccaatggaatcatgaa
aaccgttttaccggctggacggatgttgaattatcggcaaaaggtcgcaccgaatcaaag
atagctggtaaaatattgaaatcagcaggttataaatttgatgttgcctacacctctgta
ctgaaacgagctattaacaccctatggtatatactaaccgaactagatcaggtttggcta
ccagtggaaaaatcctggcgtttgaacgagcgtcattatggtgcactacagggactcaac
aaagctaaaacagcagcaaaatacggtgatgaactggttaaacaatggcggcgtagttta
gcgattattcctcctgcactaaccatcgatgaccagcgtttcccaggccacgatatacgc
tatgccaaattaaccgctaacgaattaccaaccacagaaagcctggcgttgactatcgat
cgcgttctgccttactggaaagaaaatattttacctcgtatgaagaacggtgaaagggtg
atcatcacagcccacggtaactccattcgagcaatggtaaaatttctggataatcttagc
gaagaagtgatcacagaactaaatattcctacaggtataccattagtgtacgaatttgac
aaaaatatacaagttattaatcattactaccttggtaacgctgatgagatagcataa

DBGET integrated database retrieval system