KEGG   Candidatus Moranella endobia PCIT: MEPCIT_112Help
Entry
MEPCIT_112        CDS       T01562                                 

Definition
(GenBank) putative bifunctional indole-3-glycerol phosphate synthase (trpC)/phosphoribosylanthranilate isomerase (trpF)
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
men  Candidatus Moranella endobia PCIT
Pathway
men00400  Phenylalanine, tyrosine and tryptophan biosynthesis
men01100  Metabolic pathways
men01110  Biosynthesis of secondary metabolites
men01130  Biosynthesis of antibiotics
men01230  Biosynthesis of amino acids
Module
men_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:men00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MEPCIT_112
Enzymes [BR:men01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     MEPCIT_112
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     MEPCIT_112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: AEI74770
UniProt: F7XXE4
Position
130472..131827
Genome map
AA seq 451 aa AA seqDB search
MQDKILETIVAAKYKWVANRKQLQPLDSFFYQVHPSTRSFYQALSGTRTSFILECKQASP
SKGIIRANFDPLAIAGVYRHYSSAISVLTEEKSFQGSFDFLRQVRQTVGQPILCKDFIID
PWQIYLARLYQADAILLMLSVLDDDTYCTLTSVAHSLSMGVLTEILNNAERERAIALKAQ
VVGINNRDLRDLSIDLNRTRTLGPCLPAGVTVISESGMKHYRQVHELSYYVNGFLIGSAL
MAELELMLAVNRVLLGENKVCGLTRAADARASLDAGMLYGGIIFVLGSPRQVKNNCCTVI
AGAALRYIGVFFDAPMSKITAKARALSLAAVQLHGSEDKTYIDALRQSLPIDCRIWKALN
INNTILARKLAQVERYLIDNGGGSGKPFDWLLLNDAALKNVMLAGGLGVDNCVAAASFSG
VGLDYNSGVESSPGIKDHNKLATVFQTLRAY
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacaagatacttgaaacaatagtcgccgctaaatataaatgggtggctaatcga
aaacagctgcagccgttggatagttttttttatcaggtacatcccagcacccgcagtttt
tatcaagcactgtcaggtactaggacgtcttttatcctagagtgcaaacaagcgtcgccg
tctaagggcattattcgcgctaattttgacccgctagctatcgctggggtgtaccgacat
tactcttctgctatttcggtgctaaccgaagagaaatctttccagggcagtttcgatttc
ttacgtcaagttagacaaactgtgggacagccgatcttatgcaaagattttatcatcgat
ccctggcagatttacctagctagattgtatcaggctgacgctattttactgatgttatcc
gtcctggatgatgatacctactgtacactaacttcagtggcccacagcctaagtatggga
gtgttgactgaaatattaaacaatgccgagcgcgagcgagcgattgcgctgaaagcgcag
gtggttggtatcaataatcgagatttacgtgatttgtccatagatttgaaccgcacccgc
acccttggtccttgtcttccagcaggagtcacggtcattagcgagtctggcatgaagcat
tatcgtcaagtacacgaactaagctactacgtcaatggttttcttattggtagtgcgcta
atggccgaactagaattgatgctggcggtaaacagggtgctactaggggaaaacaaagtc
tgtggtttgacccgcgccgctgatgcgcgcgcttctttggatgccggcatgctttacggt
gggatcatttttgttcttggttctcctaggcaggtcaaaaataattgctgcaccgtcatt
gccggtgcagcgctgcgctatattggtgtgttttttgatgctccgatgagcaaaattact
gctaaagcaagagcactatcgttggcagcagtacagttacacggtagcgaagataagacc
tatattgacgctctgcgtcagtcactgccaatcgattgccgtatatggaaagcactaaat
ataaacaataccatactggcacgcaaactggcccaagtagagcgctatttgattgacaat
ggtggcggcagcggcaaacctttcgactggttgctattaaatgatgcagcgctaaagaac
gtcatgcttgctggcggtctgggtgtagataattgtgtggccgctgccagttttagcggc
gttggcctggattacaattctggagtcgaaagttcacctggtattaaagatcataataaa
ctagcaacggtatttcaaacgctgcgtgcatattaa

DBGET integrated database retrieval system