KEGG   Candidatus Moranella endobia PCIT: MEPCIT_113Help
Entry
MEPCIT_113        CDS       T01562                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
men  Candidatus Moranella endobia PCIT
Pathway
men00260  Glycine, serine and threonine metabolism
men00400  Phenylalanine, tyrosine and tryptophan biosynthesis
men01100  Metabolic pathways
men01110  Biosynthesis of secondary metabolites
men01130  Biosynthesis of antibiotics
men01230  Biosynthesis of amino acids
Module
men_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:men00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MEPCIT_113 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MEPCIT_113 (trpB)
Enzymes [BR:men01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MEPCIT_113 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEI74771
UniProt: F7XXE5
Position
131866..133056
Genome map
AA seq 396 aa AA seqDB search
MTLVNPYFGEFGGMYVPQILMPTLLQLEEAFVNAQSDHAFQAEFSSLLTHYAGRPTPLTI
CHNLTTGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
SSALLGLKCRIYMGEKDIERQSPNVFRMKLMGAEVIPVHSGSSTLKDACNEALRDWSDSY
ERAHYMLGTAAGPHPFPTIVREFQRMIGEETRAQILEHEQRLPDALIACVGGGSNAIGMF
ADFINEPDVRLIGVEPGGKGIETGNHGASLKHGRTGIYFGMKSPMMQSAEGQIEESYSIS
AGLDFPSVGPQHAYLDSIGRAEYVSVTDEEALGAFQRLSRQAGIIPALESSHALAHALRM
IQEAPKKEQILVVNLSGRGDKDILTVHDILSERGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacactagttaatccttattttggcgagtttggcggtatgtatgtgccccaaattctt
atgccaacgctgctccaactggaagaggcgttcgttaacgcccaaagcgaccatgcattt
caggctgaattcagtagtctgcttacacattacgctgggcggccgacaccactaaccatt
tgccacaatctaaccaccggtactaagacaaaattgtatctgaaacgagaagacttacta
cacggtggcgcccataaaaccaaccaggtattgggccaagcactcttggccaaacgcatg
ggaaaaacagaaattatcgctgaaactggtgctggccagcacggcgtagcatcggcactt
tcttctgcattgcttgggctgaaatgccgcatttatatgggtgaaaaagatattgagcgc
cagtcaccgaacgtatttcgtatgaagctgatgggtgcagaggtcattccagtacacagc
ggttcctctaccctaaaagatgcctgcaacgaagctttgcgcgactggtccgacagttat
gaaagagctcactatatgctaggcaccgctgccggtccacatccgttccctaccatcgtg
cgcgaatttcagcgaatgataggcgaggagacgcgcgcacaaatattagagcacgaacaa
cgcctgccggatgcattaattgcctgtgttggtggcggttccaacgccatcgggatgttc
gctgatttcattaatgaacctgacgtgcgcctgataggcgtggagccaggcggtaaaggt
atcgaaactggcaatcatggtgcatctcttaaacatggccggactggcatctacttcggc
atgaagtcgccgatgatgcaatccgccgaaggacagattgaggagtcatattcgatctca
gctggtttggactttccttcggttggtccccagcatgcttaccttgatagcatcggtcgc
gccgagtacgtatcggttactgatgaagaagcattgggcgcattccagcgcctatcacgc
caagctggcattataccagcgcttgaatcatcccacgctttagcccatgcgctacgtatg
attcaagaggcaccaaaaaaagaacagatactcgtagtaaatctgtctggccgaggagat
aaagatattttaaccgttcatgatattttatccgaacgaggagaaatctaa

DBGET integrated database retrieval system