KEGG   Candidatus Moranella endobia PCIT: MEPCIT_113Help
Entry
MEPCIT_113        CDS       T01562                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
men  Candidatus Moranella endobia PCIT
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:men00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MEPCIT_113 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MEPCIT_113 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MEPCIT_113 (trpB)
Enzymes [BR:men01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MEPCIT_113 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
131866..133056
Genome map
AA seq 396 aa AA seqDB search
MTLVNPYFGEFGGMYVPQILMPTLLQLEEAFVNAQSDHAFQAEFSSLLTHYAGRPTPLTI
CHNLTTGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
SSALLGLKCRIYMGEKDIERQSPNVFRMKLMGAEVIPVHSGSSTLKDACNEALRDWSDSY
ERAHYMLGTAAGPHPFPTIVREFQRMIGEETRAQILEHEQRLPDALIACVGGGSNAIGMF
ADFINEPDVRLIGVEPGGKGIETGNHGASLKHGRTGIYFGMKSPMMQSAEGQIEESYSIS
AGLDFPSVGPQHAYLDSIGRAEYVSVTDEEALGAFQRLSRQAGIIPALESSHALAHALRM
IQEAPKKEQILVVNLSGRGDKDILTVHDILSERGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacactagttaatccttattttggcgagtttggcggtatgtatgtgccccaaattctt
atgccaacgctgctccaactggaagaggcgttcgttaacgcccaaagcgaccatgcattt
caggctgaattcagtagtctgcttacacattacgctgggcggccgacaccactaaccatt
tgccacaatctaaccaccggtactaagacaaaattgtatctgaaacgagaagacttacta
cacggtggcgcccataaaaccaaccaggtattgggccaagcactcttggccaaacgcatg
ggaaaaacagaaattatcgctgaaactggtgctggccagcacggcgtagcatcggcactt
tcttctgcattgcttgggctgaaatgccgcatttatatgggtgaaaaagatattgagcgc
cagtcaccgaacgtatttcgtatgaagctgatgggtgcagaggtcattccagtacacagc
ggttcctctaccctaaaagatgcctgcaacgaagctttgcgcgactggtccgacagttat
gaaagagctcactatatgctaggcaccgctgccggtccacatccgttccctaccatcgtg
cgcgaatttcagcgaatgataggcgaggagacgcgcgcacaaatattagagcacgaacaa
cgcctgccggatgcattaattgcctgtgttggtggcggttccaacgccatcgggatgttc
gctgatttcattaatgaacctgacgtgcgcctgataggcgtggagccaggcggtaaaggt
atcgaaactggcaatcatggtgcatctcttaaacatggccggactggcatctacttcggc
atgaagtcgccgatgatgcaatccgccgaaggacagattgaggagtcatattcgatctca
gctggtttggactttccttcggttggtccccagcatgcttaccttgatagcatcggtcgc
gccgagtacgtatcggttactgatgaagaagcattgggcgcattccagcgcctatcacgc
caagctggcattataccagcgcttgaatcatcccacgctttagcccatgcgctacgtatg
attcaagaggcaccaaaaaaagaacagatactcgtagtaaatctgtctggccgaggagat
aaagatattttaaccgttcatgatattttatccgaacgaggagaaatctaa

DBGET integrated database retrieval system