KEGG   Candidatus Moranella endobia PCIT: MEPCIT_114Help
Entry
MEPCIT_114        CDS       T01562                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
men  Candidatus Moranella endobia PCIT
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:men00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MEPCIT_114 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MEPCIT_114 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MEPCIT_114 (trpA)
Enzymes [BR:men01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MEPCIT_114 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
133058..133864
Genome map
AA seq 268 aa AA seqDB search
MERYQKLFSKLTSRTEGAFVPFVTLGDPSPVLSLQIIDTLISAGADALELGIPFSDPLAD
GPTIQKANLRAFAAGVTPAHCFELLSSIRAKYAEIPIGLLMYANLVYNEGIDSFYARCAA
VGVDSVLVADVPLQESLLFRQAALRHDVAPIFICPPNADSELLHEIAFYGRAYTYLLSRA
GVTGSEKRANKPLTQLVNALKKYKAAPILQGFGIAEPIQVRAALQAGTAGAISGSAIVRI
IEEHVDHSTLMLEKLSLFVSAMKAATRC
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctatcagaaattatttagcaagctaacttcacgcactgaaggcgctttcgtg
ccgtttgtgacgcttggtgatcctagtcctgtactatcgctgcaaattatcgatactctt
attagcgcaggggccgatgctttagaactaggcataccgttctccgatccattggccgat
ggcccaactattcaaaaagccaacctgcgcgcgtttgccgccggcgtaacgccggcacac
tgttttgaactactatcatccattcgtgcaaaatacgctgagataccaattggattgcta
atgtatgccaatttggtatataacgaaggtattgactctttctacgcccgctgcgccgct
gttggcgttgactcagtgcttgtagctgacgtgccgctgcaagaaagcctactatttcgc
caagctgcgttacgccatgatgtggcaccaatttttatttgtccaccaaacgctgacagc
gagctgctgcacgaaatagctttttacggccgagcgtatacctatctgctttcgcgtgca
ggtgtcactggcagtgaaaaaagggcaaataagccgctgacacagcttgtcaatgcattg
aagaagtataaagcagcgcccatacttcagggcttcggtattgctgaacccatccaagta
cgcgctgctttgcaggctggtaccgcaggtgctatctcaggctcggccatcgtgcgtatt
attgaagagcatgtggatcattcaacactgatgctagaaaaattgtcactattcgttagt
gcaatgaaagctgccacccgctgttga

DBGET integrated database retrieval system