KEGG   Candidatus Moranella endobia PCIT: MEPCIT_114Help
Entry
MEPCIT_114        CDS       T01562                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
men  Candidatus Moranella endobia PCIT
Pathway
men00260  Glycine, serine and threonine metabolism
men00400  Phenylalanine, tyrosine and tryptophan biosynthesis
men01100  Metabolic pathways
men01110  Biosynthesis of secondary metabolites
men01130  Biosynthesis of antibiotics
men01230  Biosynthesis of amino acids
Module
men_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:men00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MEPCIT_114 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MEPCIT_114 (trpA)
Enzymes [BR:men01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MEPCIT_114 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA NMO NanE
Motif
Other DBs
NCBI-ProteinID: AEI74772
UniProt: F7XXE6
Position
133058..133864
Genome map
AA seq 268 aa AA seqDB search
MERYQKLFSKLTSRTEGAFVPFVTLGDPSPVLSLQIIDTLISAGADALELGIPFSDPLAD
GPTIQKANLRAFAAGVTPAHCFELLSSIRAKYAEIPIGLLMYANLVYNEGIDSFYARCAA
VGVDSVLVADVPLQESLLFRQAALRHDVAPIFICPPNADSELLHEIAFYGRAYTYLLSRA
GVTGSEKRANKPLTQLVNALKKYKAAPILQGFGIAEPIQVRAALQAGTAGAISGSAIVRI
IEEHVDHSTLMLEKLSLFVSAMKAATRC
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctatcagaaattatttagcaagctaacttcacgcactgaaggcgctttcgtg
ccgtttgtgacgcttggtgatcctagtcctgtactatcgctgcaaattatcgatactctt
attagcgcaggggccgatgctttagaactaggcataccgttctccgatccattggccgat
ggcccaactattcaaaaagccaacctgcgcgcgtttgccgccggcgtaacgccggcacac
tgttttgaactactatcatccattcgtgcaaaatacgctgagataccaattggattgcta
atgtatgccaatttggtatataacgaaggtattgactctttctacgcccgctgcgccgct
gttggcgttgactcagtgcttgtagctgacgtgccgctgcaagaaagcctactatttcgc
caagctgcgttacgccatgatgtggcaccaatttttatttgtccaccaaacgctgacagc
gagctgctgcacgaaatagctttttacggccgagcgtatacctatctgctttcgcgtgca
ggtgtcactggcagtgaaaaaagggcaaataagccgctgacacagcttgtcaatgcattg
aagaagtataaagcagcgcccatacttcagggcttcggtattgctgaacccatccaagta
cgcgctgctttgcaggctggtaccgcaggtgctatctcaggctcggccatcgtgcgtatt
attgaagagcatgtggatcattcaacactgatgctagaaaaattgtcactattcgttagt
gcaatgaaagctgccacccgctgttga

DBGET integrated database retrieval system