KEGG   Candidatus Moranella endobia PCIT: MEPCIT_195Help
Entry
MEPCIT_195        CDS       T01562                                 

Definition
(GenBank) putative dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
men  Candidatus Moranella endobia PCIT
Pathway
men00010  Glycolysis / Gluconeogenesis
men00020  Citrate cycle (TCA cycle)
men00620  Pyruvate metabolism
men01100  Metabolic pathways
men01110  Biosynthesis of secondary metabolites
men01120  Microbial metabolism in diverse environments
men01130  Biosynthesis of antibiotics
men01200  Carbon metabolism
Module
men_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:men00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MEPCIT_195
   00020 Citrate cycle (TCA cycle)
    MEPCIT_195
   00620 Pyruvate metabolism
    MEPCIT_195
Enzymes [BR:men01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MEPCIT_195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3 RnfC_N HlyD_D23
Motif
Other DBs
NCBI-ProteinID: AEI74845
UniProt: F7XXL9
Position
228885..230159
Genome map
AA seq 424 aa AA seqDB search
MTIEINVPDIGVDEVEVTEVMVSVGDIVEAEQPLLTVEGDKAAMEVPAPFAGTVKEIKIN
VGDKVSTGSQIMVFDVEDTQPTVTNQMPVNTNNSTVTTPAPSLTSCTNRGELLENAAYVH
ATPVIRRLAREYGINLEKIKGSGRKGRILREDIHAYIKKAVKHDDEEAAGDSRLPLGIML
RPWPTLDFRQFGDTEEIEMERIQRISSANLQRNWVIIPHVTQFDEADITEVEAFRKQHNI
ELEKKQTNVKMTLLVFIIKAIANTLEELPRFNSSLAEETHKLILKKYVNIGVAVDTMNGL
VVPVLRDVNKKGMVALSSELTVISNKARAGKLTASDMQGGCFTISSLGGIGGKFFTPIVN
APEVAILGVSKAAMKPVWNGNEFVPRLMLPLALSYDHRVIDGADGARFISFLNHLLSDIR
RLLM
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgacgattgaaataaatgtaccggatataggtgtagatgaagttgaagtaacagaagtt
atggtcagcgtaggcgatatagttgaagctgagcagccactactgaccgtggaaggtgac
aaggcggcaatggaagtaccggcgccattcgcagggaccgtcaaagagataaaaattaac
gtcggtgacaaagtaagtactggatcgcagattatggtattcgatgtggaagatactcaa
cctaccgtaaccaaccagatgccggtaaataccaacaatagcactgttactacacctgca
ccatcgctaacctcatgtaccaacagaggcgaattattggagaacgcagcctacgtgcat
gcgactccagtgattcggcgactagcacgcgaatacggtatcaacctagagaagataaaa
ggcagcgggcgtaaaggccgcattcttcgcgaagatatccacgcgtatatcaaaaaagcg
gtaaaacacgacgacgaagaggcggccggagacagcagattaccactaggtattatgcta
cggccatggccaacattggactttagacagttcggtgataccgaagagattgagatggaa
cgaatccagagaatctctagtgcaaacttacaacgtaactgggtaattattccccatgtg
acacagttcgacgaagccgatattaccgaggtagaagccttccgcaaacaacataatatc
gaattggaaaaaaaacagacgaatgttaaaatgactctactagtgttcattataaaggca
atcgctaatactctggaagagttacctcgttttaacagctcactagctgaagaaactcat
aaactgatactaaaaaaatatgtaaatatcggggtagcagtagataccatgaatggcctg
gtggtgccagtcttacgagatgtgaataaaaaaggcatggtagcactttcaagcgagttg
acggtcatatcgaacaaggctagggccggcaagctgactgcatctgatatgcagggcggt
tgtttcactatttctagcctaggcggtatcggtggtaagtttttcacgccaattgtcaat
gcgccagaagtagcaatactcggtgtttctaaggctgcgatgaagccagtgtggaacggt
aacgagttcgtgcccaggttgatgttgccgttggcgctatcctatgaccaccgggtgatt
gatggtgctgatggcgcacgctttatcagttttctcaatcacttactgtccgatatccgt
cgattattaatgtaa

DBGET integrated database retrieval system